Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RP04

Protein Details
Accession A0A372RP04    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-78LESHFNKIWNKKQRERLKRVQDTDANHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001487  Bromodomain  
IPR036427  Bromodomain-like_sf  
Pfam View protein in Pfam  
PF00439  Bromodomain  
PROSITE View protein in PROSITE  
PS50014  BROMODOMAIN_2  
Amino Acid Sequences IKNPMDLFTINSKLENNQYTSTEEFEKDIRLIFRNCYTYNNVGSEIYCLGEELESHFNKIWNKKQRERLKRVQDTDANSSGKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.28
4 0.25
5 0.27
6 0.29
7 0.29
8 0.29
9 0.25
10 0.22
11 0.2
12 0.18
13 0.18
14 0.15
15 0.15
16 0.15
17 0.16
18 0.17
19 0.18
20 0.21
21 0.24
22 0.24
23 0.25
24 0.27
25 0.26
26 0.27
27 0.25
28 0.22
29 0.18
30 0.18
31 0.16
32 0.12
33 0.09
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.08
40 0.13
41 0.13
42 0.15
43 0.15
44 0.19
45 0.24
46 0.31
47 0.38
48 0.42
49 0.51
50 0.59
51 0.68
52 0.76
53 0.82
54 0.84
55 0.86
56 0.86
57 0.87
58 0.84
59 0.82
60 0.77
61 0.72
62 0.7
63 0.66
64 0.56