Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RTQ7

Protein Details
Accession A0A372RTQ7   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-45QVCHARVSQKKKRQWSAREKLMIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12, cyto 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MREFITVYFRVLQLIWLVHGNFQVCHARVSQKKKRQWSAREKLMIIAYYEQGHSKQSTADKFEIEPIQLREWLRNKDQLMKVAPYVQKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.13
5 0.13
6 0.15
7 0.15
8 0.13
9 0.15
10 0.19
11 0.17
12 0.18
13 0.19
14 0.25
15 0.31
16 0.41
17 0.48
18 0.52
19 0.59
20 0.68
21 0.76
22 0.77
23 0.81
24 0.82
25 0.81
26 0.8
27 0.76
28 0.67
29 0.59
30 0.51
31 0.41
32 0.31
33 0.22
34 0.15
35 0.11
36 0.11
37 0.1
38 0.09
39 0.1
40 0.1
41 0.09
42 0.11
43 0.16
44 0.18
45 0.23
46 0.23
47 0.23
48 0.23
49 0.27
50 0.25
51 0.21
52 0.22
53 0.2
54 0.21
55 0.24
56 0.24
57 0.27
58 0.32
59 0.37
60 0.37
61 0.42
62 0.42
63 0.48
64 0.51
65 0.51
66 0.49
67 0.46
68 0.44
69 0.45
70 0.45