Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QY79

Protein Details
Accession A0A372QY79    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-37VTNGRKNKVSQKKKASIKPKDESHydrophilic
NLS Segment(s)
PositionSequence
22-30KVSQKKKAS
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MNNENDANSNGLNTVTNGRKNKVSQKKKASIKPKDESSFTDKVANSFKDDTSRRKFDLNKLVNIIREAVMHPIYSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.26
4 0.29
5 0.31
6 0.36
7 0.4
8 0.49
9 0.54
10 0.59
11 0.62
12 0.69
13 0.76
14 0.79
15 0.83
16 0.83
17 0.82
18 0.81
19 0.77
20 0.74
21 0.68
22 0.6
23 0.56
24 0.52
25 0.45
26 0.37
27 0.35
28 0.28
29 0.27
30 0.3
31 0.27
32 0.23
33 0.22
34 0.22
35 0.24
36 0.28
37 0.35
38 0.38
39 0.42
40 0.4
41 0.46
42 0.49
43 0.51
44 0.59
45 0.56
46 0.52
47 0.53
48 0.54
49 0.49
50 0.46
51 0.39
52 0.28
53 0.24
54 0.2
55 0.2
56 0.18