Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QJ31

Protein Details
Accession A0A372QJ31    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-33ITNPNITKRKGRPPKRLQSNVEKSLHydrophilic
NLS Segment(s)
PositionSequence
16-24KRKGRPPKR
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MKIILPTSITNPNITKRKGRPPKRLQSNVEKSLTKNKHVLRNSYVYNDENAEDVEGSKGLLLGPLESLGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.47
4 0.58
5 0.65
6 0.72
7 0.75
8 0.78
9 0.86
10 0.88
11 0.9
12 0.85
13 0.85
14 0.83
15 0.78
16 0.71
17 0.62
18 0.52
19 0.54
20 0.5
21 0.42
22 0.4
23 0.38
24 0.43
25 0.45
26 0.48
27 0.42
28 0.44
29 0.43
30 0.4
31 0.38
32 0.3
33 0.29
34 0.25
35 0.21
36 0.17
37 0.15
38 0.12
39 0.09
40 0.09
41 0.08
42 0.07
43 0.07
44 0.06
45 0.06
46 0.05
47 0.07
48 0.07
49 0.07
50 0.07