Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QD84

Protein Details
Accession A0A372QD84    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
63-106PVLVLLKLKNKRRNKNPQLLVPVLPKLKNKRRNKNLRKIMGHFTHydrophilic
NLS Segment(s)
PositionSequence
71-100KNKRRNKNPQLLVPVLPKLKNKRRNKNLRK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MKQSGKKSVEKSRQESHKQTSSQKFVSSDSSKQTSISKQQSTASGSGFAKTQKQASKQNLQLPVLVLLKLKNKRRNKNPQLLVPVLPKLKNKRRNKNLRKIMGHFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.76
4 0.73
5 0.7
6 0.72
7 0.72
8 0.68
9 0.62
10 0.57
11 0.51
12 0.44
13 0.47
14 0.42
15 0.36
16 0.35
17 0.36
18 0.32
19 0.32
20 0.33
21 0.3
22 0.34
23 0.38
24 0.35
25 0.33
26 0.35
27 0.37
28 0.36
29 0.33
30 0.25
31 0.21
32 0.19
33 0.18
34 0.17
35 0.15
36 0.15
37 0.15
38 0.19
39 0.18
40 0.23
41 0.31
42 0.36
43 0.42
44 0.45
45 0.49
46 0.49
47 0.46
48 0.42
49 0.35
50 0.32
51 0.25
52 0.2
53 0.15
54 0.13
55 0.2
56 0.26
57 0.34
58 0.41
59 0.5
60 0.6
61 0.7
62 0.8
63 0.83
64 0.86
65 0.85
66 0.83
67 0.81
68 0.73
69 0.66
70 0.58
71 0.53
72 0.47
73 0.43
74 0.42
75 0.45
76 0.53
77 0.6
78 0.67
79 0.73
80 0.8
81 0.88
82 0.92
83 0.93
84 0.94
85 0.94
86 0.92