Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QKW9

Protein Details
Accession A0A372QKW9   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
80-101SGDEGKNKIKKNSKKLKIVTKIHydrophilic
NLS Segment(s)
PositionSequence
60-70KELKRKRGKKV
84-97GKNKIKKNSKKLKI
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MRELTRSIINEKWIKVSKIKGDKDIIYKISDRYMDKIQKLFWNERCEETIELEKTRGITKELKRKRGKKVIESEGDEGSSGDEGKNKIKKNSKKLKIVTKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.46
4 0.48
5 0.53
6 0.55
7 0.53
8 0.53
9 0.54
10 0.54
11 0.53
12 0.45
13 0.38
14 0.36
15 0.31
16 0.3
17 0.3
18 0.25
19 0.24
20 0.31
21 0.33
22 0.34
23 0.35
24 0.34
25 0.35
26 0.38
27 0.41
28 0.39
29 0.4
30 0.39
31 0.38
32 0.37
33 0.35
34 0.31
35 0.26
36 0.25
37 0.2
38 0.19
39 0.18
40 0.16
41 0.15
42 0.16
43 0.15
44 0.13
45 0.19
46 0.26
47 0.36
48 0.43
49 0.53
50 0.61
51 0.68
52 0.76
53 0.78
54 0.78
55 0.77
56 0.79
57 0.77
58 0.74
59 0.71
60 0.63
61 0.54
62 0.47
63 0.38
64 0.28
65 0.2
66 0.13
67 0.09
68 0.07
69 0.1
70 0.12
71 0.19
72 0.26
73 0.3
74 0.39
75 0.49
76 0.58
77 0.66
78 0.76
79 0.78
80 0.81
81 0.86