Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QFN3

Protein Details
Accession A0A372QFN3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MNNKNQQKKIEKLKKFKKFWSIRIGKKIKHydrophilic
NLS Segment(s)
PositionSequence
8-27KKIEKLKKFKKFWSIRIGKK
Subcellular Location(s) mito 7.5, plas 5, E.R. 5, cyto_mito 4.5, golg 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MNNKNQQKKIEKLKKFKKFWSIRIGKKIKINYMFDALHYNVLQVIGTLILAFTKVLVEMISCGGVEEVEDGNNPQANGGAGDSKKGFTKELQDVYNDLSPKARIYCNVLEATKIRRSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.84
5 0.82
6 0.8
7 0.8
8 0.79
9 0.77
10 0.81
11 0.78
12 0.72
13 0.7
14 0.68
15 0.64
16 0.62
17 0.57
18 0.49
19 0.49
20 0.44
21 0.38
22 0.37
23 0.29
24 0.24
25 0.2
26 0.17
27 0.12
28 0.12
29 0.11
30 0.06
31 0.06
32 0.04
33 0.03
34 0.03
35 0.03
36 0.02
37 0.03
38 0.03
39 0.02
40 0.02
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.06
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.1
67 0.09
68 0.11
69 0.12
70 0.13
71 0.15
72 0.16
73 0.17
74 0.14
75 0.22
76 0.27
77 0.31
78 0.31
79 0.3
80 0.3
81 0.33
82 0.35
83 0.28
84 0.21
85 0.19
86 0.19
87 0.2
88 0.23
89 0.21
90 0.19
91 0.26
92 0.29
93 0.31
94 0.35
95 0.33
96 0.32
97 0.34
98 0.37