Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RS36

Protein Details
Accession A0A372RS36   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
202-223LTNYIKKRKAEREEKENRKRLNBasic
NLS Segment(s)
PositionSequence
211-224KKRKAEREEKENRK
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
IPR007527  Znf_SWIM  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
Amino Acid Sequences MNSFTESVGNHEILELSEYEAYKKFAEFLEDKYEDRKIYIKCLLDEINXINIVQIWEVTSLLSKKTCQFVLLLRNGMHACTCMLLVNYGVICRHYFKVXLECENARFXIGMIPRRWYKEELQLQEEQIKNAPIIXTGGGVLNFSDTFQIENSDFTQIQPLFNQYYQPPTTQRQAIKKSQYAMLTGLSRDATRLALEDGDNELKTLLTNYIKKRKAEREEKENRKRLNAIENTIDIENNNHEGQILFESEDRVYTTDQVKNPLKHIAKGRPANTRLKSSLEIHKKRGGYIGKENLVQNDKVNRKEYVCSKCKEVGHNARTCKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.12
3 0.1
4 0.13
5 0.13
6 0.15
7 0.16
8 0.18
9 0.17
10 0.17
11 0.17
12 0.15
13 0.22
14 0.22
15 0.24
16 0.31
17 0.32
18 0.33
19 0.34
20 0.37
21 0.31
22 0.31
23 0.33
24 0.26
25 0.31
26 0.36
27 0.37
28 0.34
29 0.38
30 0.38
31 0.33
32 0.34
33 0.29
34 0.28
35 0.24
36 0.23
37 0.19
38 0.17
39 0.15
40 0.12
41 0.11
42 0.06
43 0.06
44 0.06
45 0.09
46 0.1
47 0.13
48 0.14
49 0.15
50 0.18
51 0.23
52 0.23
53 0.2
54 0.21
55 0.25
56 0.32
57 0.34
58 0.34
59 0.3
60 0.33
61 0.33
62 0.31
63 0.26
64 0.17
65 0.13
66 0.1
67 0.1
68 0.07
69 0.07
70 0.08
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.12
79 0.13
80 0.13
81 0.14
82 0.15
83 0.24
84 0.25
85 0.3
86 0.29
87 0.3
88 0.3
89 0.29
90 0.27
91 0.19
92 0.17
93 0.19
94 0.21
95 0.23
96 0.26
97 0.31
98 0.33
99 0.36
100 0.39
101 0.34
102 0.4
103 0.44
104 0.43
105 0.42
106 0.41
107 0.39
108 0.42
109 0.4
110 0.3
111 0.24
112 0.21
113 0.16
114 0.15
115 0.13
116 0.07
117 0.07
118 0.06
119 0.07
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.04
128 0.05
129 0.05
130 0.05
131 0.07
132 0.07
133 0.08
134 0.09
135 0.1
136 0.1
137 0.1
138 0.16
139 0.14
140 0.14
141 0.14
142 0.15
143 0.14
144 0.14
145 0.16
146 0.11
147 0.16
148 0.17
149 0.18
150 0.19
151 0.21
152 0.24
153 0.28
154 0.32
155 0.35
156 0.4
157 0.45
158 0.48
159 0.47
160 0.46
161 0.44
162 0.4
163 0.33
164 0.28
165 0.23
166 0.18
167 0.16
168 0.15
169 0.11
170 0.1
171 0.09
172 0.09
173 0.07
174 0.06
175 0.07
176 0.07
177 0.07
178 0.07
179 0.08
180 0.1
181 0.11
182 0.11
183 0.1
184 0.1
185 0.08
186 0.08
187 0.08
188 0.09
189 0.12
190 0.18
191 0.25
192 0.35
193 0.4
194 0.43
195 0.51
196 0.57
197 0.63
198 0.68
199 0.68
200 0.7
201 0.76
202 0.84
203 0.86
204 0.85
205 0.77
206 0.71
207 0.67
208 0.6
209 0.59
210 0.52
211 0.46
212 0.4
213 0.39
214 0.36
215 0.33
216 0.3
217 0.19
218 0.16
219 0.14
220 0.14
221 0.13
222 0.11
223 0.11
224 0.11
225 0.12
226 0.12
227 0.11
228 0.08
229 0.09
230 0.11
231 0.11
232 0.11
233 0.11
234 0.11
235 0.11
236 0.14
237 0.18
238 0.23
239 0.25
240 0.33
241 0.39
242 0.4
243 0.42
244 0.48
245 0.45
246 0.45
247 0.51
248 0.52
249 0.54
250 0.6
251 0.63
252 0.63
253 0.66
254 0.7
255 0.66
256 0.64
257 0.57
258 0.54
259 0.53
260 0.48
261 0.53
262 0.55
263 0.57
264 0.56
265 0.6
266 0.56
267 0.53
268 0.56
269 0.53
270 0.48
271 0.52
272 0.55
273 0.51
274 0.54
275 0.54
276 0.53
277 0.5
278 0.45
279 0.4
280 0.41
281 0.44
282 0.46
283 0.48
284 0.45
285 0.44
286 0.51
287 0.55
288 0.55
289 0.57
290 0.54
291 0.57
292 0.6
293 0.62
294 0.61
295 0.63
296 0.64
297 0.65
298 0.69