Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QGJ7

Protein Details
Accession A0A372QGJ7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
59-79VSKCHSKANYHRKKMNKMFRDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, mito 4, cysk 3
Family & Domain DBs
Amino Acid Sequences MEAEYICQYLSDEGIVCGGGSTRPEGCSIHWKRCQRSLCKQDGCIRPTASKYGYYNWHVSKCHSKANYHRKKMNKMFRDGQIPEALEQALDKILQQVKLSLESCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.08
9 0.09
10 0.1
11 0.12
12 0.13
13 0.15
14 0.25
15 0.29
16 0.36
17 0.43
18 0.49
19 0.51
20 0.59
21 0.65
22 0.62
23 0.68
24 0.68
25 0.7
26 0.66
27 0.67
28 0.68
29 0.67
30 0.61
31 0.54
32 0.47
33 0.39
34 0.37
35 0.35
36 0.27
37 0.23
38 0.23
39 0.21
40 0.24
41 0.25
42 0.29
43 0.28
44 0.3
45 0.28
46 0.3
47 0.36
48 0.34
49 0.38
50 0.36
51 0.39
52 0.46
53 0.57
54 0.64
55 0.63
56 0.67
57 0.68
58 0.76
59 0.81
60 0.81
61 0.77
62 0.74
63 0.72
64 0.7
65 0.7
66 0.61
67 0.54
68 0.48
69 0.42
70 0.34
71 0.29
72 0.24
73 0.16
74 0.14
75 0.12
76 0.08
77 0.07
78 0.07
79 0.12
80 0.15
81 0.18
82 0.18
83 0.2
84 0.22
85 0.27