Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R371

Protein Details
Accession A0A372R371    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
33-52LPIRSIFEKKKKKIRINFDDHydrophilic
NLS Segment(s)
PositionSequence
42-45KKKK
Subcellular Location(s) plas 8, mito 7, E.R. 5, pero 3, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGDNIFEQQYIVLIYKHKNFLFWFCSIFGLFFLPIRSIFEKKKKKIRINFDDDLHHVDLSFFFILLLLSSPFFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.27
4 0.26
5 0.28
6 0.28
7 0.32
8 0.33
9 0.3
10 0.27
11 0.22
12 0.23
13 0.2
14 0.19
15 0.14
16 0.11
17 0.1
18 0.08
19 0.08
20 0.08
21 0.08
22 0.1
23 0.12
24 0.15
25 0.2
26 0.29
27 0.38
28 0.45
29 0.55
30 0.62
31 0.69
32 0.74
33 0.8
34 0.8
35 0.79
36 0.77
37 0.7
38 0.64
39 0.56
40 0.52
41 0.42
42 0.32
43 0.24
44 0.19
45 0.16
46 0.16
47 0.14
48 0.09
49 0.07
50 0.08
51 0.08
52 0.08
53 0.09
54 0.07