Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QA82

Protein Details
Accession A0A372QA82    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MLQVNAKRFKKNKKFDDHVKDVDFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7.5, cyto_nucl 7.5, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MLQVNAKRFKKNKKFDDHVKDVDFFREFNKVKNTVFAINNWVKALERFCETKGYSEKIENVENVEELDKQLSDNIFTSFSKTVNRKIKYLTDLSHGEANGSDGLTAKEIKYWSKSRQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.89
4 0.86
5 0.81
6 0.74
7 0.66
8 0.57
9 0.52
10 0.42
11 0.32
12 0.26
13 0.29
14 0.26
15 0.28
16 0.34
17 0.33
18 0.32
19 0.36
20 0.37
21 0.33
22 0.33
23 0.29
24 0.3
25 0.29
26 0.3
27 0.26
28 0.24
29 0.18
30 0.19
31 0.19
32 0.13
33 0.13
34 0.14
35 0.15
36 0.19
37 0.19
38 0.23
39 0.25
40 0.26
41 0.24
42 0.24
43 0.26
44 0.23
45 0.24
46 0.19
47 0.17
48 0.14
49 0.13
50 0.12
51 0.1
52 0.08
53 0.07
54 0.07
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.08
61 0.09
62 0.1
63 0.1
64 0.14
65 0.13
66 0.14
67 0.2
68 0.22
69 0.3
70 0.38
71 0.4
72 0.39
73 0.42
74 0.47
75 0.46
76 0.48
77 0.4
78 0.37
79 0.36
80 0.36
81 0.35
82 0.29
83 0.25
84 0.2
85 0.2
86 0.15
87 0.13
88 0.1
89 0.08
90 0.09
91 0.1
92 0.11
93 0.1
94 0.13
95 0.15
96 0.19
97 0.26
98 0.32