Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q5Y4

Protein Details
Accession A0A372Q5Y4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
27-46LFPTQHFKRKVKRLERDIKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 16, cyto 9
Family & Domain DBs
Amino Acid Sequences MVIDQNYLSDSTPTEQEDVKETIGRLLFPTQHFKRKVKRLERDIKSLETELKDLDKCVDRETLVDLIHEIPSKESDSVKRIVIKKSEDIPHALAPLAKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.21
5 0.21
6 0.2
7 0.2
8 0.18
9 0.2
10 0.19
11 0.19
12 0.16
13 0.17
14 0.19
15 0.2
16 0.29
17 0.3
18 0.38
19 0.43
20 0.48
21 0.55
22 0.6
23 0.68
24 0.69
25 0.74
26 0.76
27 0.81
28 0.79
29 0.77
30 0.71
31 0.62
32 0.54
33 0.45
34 0.37
35 0.27
36 0.23
37 0.16
38 0.15
39 0.14
40 0.12
41 0.13
42 0.14
43 0.14
44 0.15
45 0.16
46 0.14
47 0.15
48 0.17
49 0.17
50 0.13
51 0.13
52 0.12
53 0.11
54 0.13
55 0.13
56 0.11
57 0.09
58 0.11
59 0.13
60 0.13
61 0.15
62 0.18
63 0.2
64 0.23
65 0.25
66 0.31
67 0.34
68 0.38
69 0.42
70 0.43
71 0.45
72 0.5
73 0.52
74 0.48
75 0.48
76 0.45
77 0.41
78 0.38
79 0.33