Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QPT7

Protein Details
Accession A0A372QPT7   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
157-176ISDLKKSLKKDKNPDDEQKIHydrophilic
399-419PIGHHHPKLRRYTKKIHVMNYBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, plas 4, pero 2, golg 2, mito 1.5, cyto_mito 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR002921  Fungal_lipase-like  
Gene Ontology GO:0016020  C:membrane  
GO:0016787  F:hydrolase activity  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF01764  Lipase_3  
CDD cd00519  Lipase_3  
Amino Acid Sequences MDSEKTAPNNVIEMIDRPHIVDLENTPKGIISESLENVPLIYPSVNYLIYFKRTLQHLFLTLLFDWTNIITSPINFLLTFVFFPLVAIVLFLLEIILRFISFMKWDVNDDERIKALDEPPNKYRKGFDLNSAQFLLYLSAILQERDEKKVTEAYRMISDLKKSLKKDKNPDDEQKIRKIYEILKKSESGIHKQLEEFDIKFTSLSELNTLGGPYAGMFWSDKGNFIVIAIKGTTPTNFNEWLTNATFQRMDARSYLFGEVHEGFYTQLFPADEYDSIRVDRMCPATRIIDAVRIKAESIRKRNGENNHKTPEDTPLVNVYVTGHSLGGALATLLYARLMKSPQSLGKDCLLRDGTVFASLSIGDSDFSAEFSSLSNKSNDEYKTLWRIVCDNDIAPRVPIGHHHPKLRRYTKKIHVMNYFHVGNEVRFYQDGSTPSSMNNIFTDDKELIFIERGLSWKDWRGLFGFYDPFDHAKHDKKATFERKLDDKLYSYEKFLIGPLSPFRNHMSHRYFAALEKSREFFENNDVNFKDKHVPGENIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.19
5 0.2
6 0.19
7 0.18
8 0.19
9 0.21
10 0.27
11 0.28
12 0.27
13 0.26
14 0.26
15 0.25
16 0.24
17 0.2
18 0.14
19 0.18
20 0.2
21 0.22
22 0.22
23 0.21
24 0.2
25 0.19
26 0.15
27 0.11
28 0.1
29 0.08
30 0.1
31 0.13
32 0.13
33 0.13
34 0.16
35 0.19
36 0.22
37 0.24
38 0.23
39 0.26
40 0.29
41 0.33
42 0.33
43 0.33
44 0.32
45 0.32
46 0.32
47 0.3
48 0.27
49 0.25
50 0.21
51 0.17
52 0.15
53 0.13
54 0.13
55 0.09
56 0.11
57 0.1
58 0.1
59 0.14
60 0.14
61 0.15
62 0.14
63 0.14
64 0.14
65 0.14
66 0.14
67 0.11
68 0.11
69 0.09
70 0.1
71 0.09
72 0.08
73 0.06
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.08
89 0.1
90 0.12
91 0.13
92 0.15
93 0.19
94 0.21
95 0.27
96 0.27
97 0.27
98 0.25
99 0.25
100 0.24
101 0.23
102 0.24
103 0.25
104 0.29
105 0.33
106 0.4
107 0.46
108 0.46
109 0.45
110 0.43
111 0.42
112 0.46
113 0.41
114 0.41
115 0.45
116 0.46
117 0.48
118 0.46
119 0.39
120 0.31
121 0.29
122 0.23
123 0.12
124 0.09
125 0.06
126 0.08
127 0.09
128 0.09
129 0.09
130 0.15
131 0.17
132 0.21
133 0.23
134 0.2
135 0.22
136 0.28
137 0.29
138 0.29
139 0.29
140 0.27
141 0.28
142 0.29
143 0.3
144 0.25
145 0.26
146 0.23
147 0.29
148 0.33
149 0.34
150 0.43
151 0.49
152 0.56
153 0.65
154 0.71
155 0.73
156 0.76
157 0.81
158 0.79
159 0.79
160 0.76
161 0.73
162 0.66
163 0.57
164 0.5
165 0.45
166 0.44
167 0.44
168 0.46
169 0.42
170 0.4
171 0.41
172 0.4
173 0.43
174 0.38
175 0.35
176 0.35
177 0.33
178 0.31
179 0.31
180 0.32
181 0.28
182 0.27
183 0.21
184 0.16
185 0.15
186 0.14
187 0.14
188 0.12
189 0.12
190 0.1
191 0.1
192 0.1
193 0.1
194 0.1
195 0.1
196 0.1
197 0.08
198 0.06
199 0.06
200 0.04
201 0.05
202 0.04
203 0.05
204 0.05
205 0.06
206 0.09
207 0.09
208 0.1
209 0.1
210 0.1
211 0.09
212 0.1
213 0.12
214 0.09
215 0.09
216 0.09
217 0.08
218 0.09
219 0.1
220 0.1
221 0.09
222 0.1
223 0.12
224 0.13
225 0.14
226 0.14
227 0.14
228 0.16
229 0.16
230 0.17
231 0.14
232 0.14
233 0.14
234 0.13
235 0.19
236 0.17
237 0.16
238 0.15
239 0.17
240 0.16
241 0.18
242 0.19
243 0.12
244 0.11
245 0.13
246 0.13
247 0.12
248 0.11
249 0.1
250 0.09
251 0.09
252 0.1
253 0.06
254 0.07
255 0.06
256 0.06
257 0.07
258 0.08
259 0.08
260 0.09
261 0.1
262 0.1
263 0.1
264 0.1
265 0.09
266 0.09
267 0.12
268 0.15
269 0.15
270 0.15
271 0.17
272 0.17
273 0.17
274 0.18
275 0.15
276 0.19
277 0.18
278 0.18
279 0.17
280 0.16
281 0.16
282 0.18
283 0.25
284 0.25
285 0.31
286 0.37
287 0.38
288 0.41
289 0.48
290 0.53
291 0.57
292 0.58
293 0.59
294 0.58
295 0.56
296 0.54
297 0.49
298 0.45
299 0.37
300 0.28
301 0.22
302 0.19
303 0.19
304 0.18
305 0.17
306 0.12
307 0.09
308 0.09
309 0.09
310 0.07
311 0.06
312 0.06
313 0.06
314 0.05
315 0.04
316 0.03
317 0.03
318 0.03
319 0.02
320 0.02
321 0.03
322 0.03
323 0.04
324 0.06
325 0.07
326 0.08
327 0.1
328 0.14
329 0.18
330 0.23
331 0.25
332 0.26
333 0.3
334 0.32
335 0.3
336 0.32
337 0.29
338 0.23
339 0.22
340 0.21
341 0.16
342 0.15
343 0.15
344 0.09
345 0.08
346 0.08
347 0.08
348 0.07
349 0.06
350 0.05
351 0.05
352 0.06
353 0.06
354 0.06
355 0.06
356 0.06
357 0.06
358 0.07
359 0.1
360 0.1
361 0.12
362 0.13
363 0.13
364 0.14
365 0.2
366 0.2
367 0.2
368 0.21
369 0.24
370 0.3
371 0.32
372 0.32
373 0.27
374 0.29
375 0.28
376 0.29
377 0.26
378 0.2
379 0.2
380 0.22
381 0.22
382 0.19
383 0.17
384 0.15
385 0.13
386 0.16
387 0.21
388 0.3
389 0.34
390 0.42
391 0.48
392 0.55
393 0.65
394 0.72
395 0.73
396 0.71
397 0.76
398 0.77
399 0.81
400 0.8
401 0.78
402 0.76
403 0.71
404 0.67
405 0.63
406 0.54
407 0.43
408 0.4
409 0.33
410 0.24
411 0.22
412 0.19
413 0.14
414 0.14
415 0.15
416 0.14
417 0.17
418 0.18
419 0.2
420 0.22
421 0.2
422 0.2
423 0.25
424 0.23
425 0.21
426 0.2
427 0.19
428 0.19
429 0.19
430 0.24
431 0.19
432 0.19
433 0.18
434 0.18
435 0.15
436 0.15
437 0.14
438 0.11
439 0.12
440 0.13
441 0.15
442 0.17
443 0.19
444 0.23
445 0.28
446 0.27
447 0.28
448 0.28
449 0.27
450 0.27
451 0.28
452 0.26
453 0.21
454 0.24
455 0.24
456 0.24
457 0.22
458 0.26
459 0.26
460 0.32
461 0.38
462 0.43
463 0.44
464 0.49
465 0.59
466 0.64
467 0.68
468 0.65
469 0.65
470 0.65
471 0.68
472 0.65
473 0.58
474 0.51
475 0.47
476 0.49
477 0.43
478 0.39
479 0.36
480 0.33
481 0.3
482 0.28
483 0.25
484 0.19
485 0.22
486 0.24
487 0.26
488 0.26
489 0.28
490 0.32
491 0.35
492 0.37
493 0.43
494 0.44
495 0.42
496 0.44
497 0.45
498 0.42
499 0.39
500 0.45
501 0.43
502 0.42
503 0.43
504 0.42
505 0.4
506 0.41
507 0.4
508 0.32
509 0.33
510 0.38
511 0.35
512 0.41
513 0.39
514 0.4
515 0.39
516 0.41
517 0.4
518 0.34
519 0.4
520 0.39