Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QEU5

Protein Details
Accession A0A372QEU5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
120-148SRYQKEITVKKEKQRSKKKISTTIKSYMEHydrophilic
NLS Segment(s)
PositionSequence
130-138KEKQRSKKK
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004088  KH_dom_type_1  
IPR036612  KH_dom_type_1_sf  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00013  KH_1  
PROSITE View protein in PROSITE  
PS50084  KH_TYPE_1  
Amino Acid Sequences MSHPGLLLISTVIPIPEHIEVGKLIGREGRNLKPISAKTGTFVSVNTNTSPAQIEIKYNPHYSPSNNQINEAKDLLNNLIKNIEKEEKRNIRLLEKKKEKNVGFLDDFDSGSVSNNRVVSRYQKEITVKKEKQRSKKKISTTIKSYMEGGLKEGWEMEMEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.1
3 0.1
4 0.1
5 0.1
6 0.11
7 0.11
8 0.13
9 0.14
10 0.11
11 0.11
12 0.15
13 0.16
14 0.21
15 0.26
16 0.29
17 0.34
18 0.35
19 0.36
20 0.38
21 0.39
22 0.4
23 0.38
24 0.33
25 0.28
26 0.29
27 0.29
28 0.22
29 0.21
30 0.19
31 0.18
32 0.2
33 0.18
34 0.18
35 0.17
36 0.17
37 0.18
38 0.14
39 0.14
40 0.13
41 0.15
42 0.16
43 0.21
44 0.24
45 0.24
46 0.23
47 0.24
48 0.25
49 0.25
50 0.28
51 0.31
52 0.36
53 0.34
54 0.37
55 0.36
56 0.36
57 0.36
58 0.31
59 0.23
60 0.15
61 0.16
62 0.15
63 0.15
64 0.13
65 0.11
66 0.12
67 0.12
68 0.12
69 0.15
70 0.2
71 0.18
72 0.21
73 0.31
74 0.35
75 0.37
76 0.42
77 0.4
78 0.42
79 0.5
80 0.55
81 0.56
82 0.59
83 0.63
84 0.64
85 0.71
86 0.63
87 0.63
88 0.58
89 0.54
90 0.45
91 0.41
92 0.37
93 0.29
94 0.29
95 0.2
96 0.17
97 0.11
98 0.11
99 0.12
100 0.1
101 0.11
102 0.13
103 0.14
104 0.15
105 0.17
106 0.22
107 0.27
108 0.32
109 0.3
110 0.34
111 0.41
112 0.46
113 0.52
114 0.56
115 0.57
116 0.59
117 0.68
118 0.71
119 0.75
120 0.8
121 0.83
122 0.82
123 0.85
124 0.86
125 0.87
126 0.88
127 0.86
128 0.82
129 0.81
130 0.74
131 0.66
132 0.58
133 0.51
134 0.45
135 0.36
136 0.31
137 0.25
138 0.21
139 0.2
140 0.19
141 0.15