Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QU86

Protein Details
Accession A0A372QU86    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-30GNFQVRCAKVSQKKKRQWSTREKLMIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5mito_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MVRGNFQVRCAKVSQKKKRQWSTREKLMIIAYYEQGHSKRSTVNKFEIEPKQLYEWLRNKDQLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.73
4 0.81
5 0.88
6 0.88
7 0.88
8 0.89
9 0.87
10 0.86
11 0.82
12 0.71
13 0.64
14 0.55
15 0.46
16 0.35
17 0.27
18 0.18
19 0.13
20 0.13
21 0.12
22 0.12
23 0.13
24 0.12
25 0.12
26 0.16
27 0.23
28 0.3
29 0.33
30 0.38
31 0.4
32 0.42
33 0.49
34 0.49
35 0.47
36 0.41
37 0.39
38 0.36
39 0.37
40 0.37
41 0.38
42 0.4
43 0.42
44 0.47