Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RB33

Protein Details
Accession A0A372RB33   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKPTSKGGKSTPKKRKKLTDELVVPWHydrophilic
NLS Segment(s)
PositionSequence
6-17KGGKSTPKKRKK
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 11, cyto_nucl 9.166
Family & Domain DBs
Amino Acid Sequences MKPTSKGGKSTPKKRKKLTDELVVPWVKKLEQIDSLNRSNHGELSINFREYFMSFCKRLESETTYQIREENFFVVINNYHNDLNQHKKQSRNDNQTDQDVNMNMNFNDTQIFSEIYLISFYATLNNNYLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.88
4 0.89
5 0.86
6 0.86
7 0.8
8 0.74
9 0.72
10 0.64
11 0.54
12 0.44
13 0.38
14 0.27
15 0.25
16 0.23
17 0.19
18 0.23
19 0.27
20 0.33
21 0.37
22 0.41
23 0.39
24 0.38
25 0.36
26 0.3
27 0.27
28 0.21
29 0.18
30 0.15
31 0.22
32 0.23
33 0.22
34 0.21
35 0.2
36 0.2
37 0.18
38 0.19
39 0.15
40 0.17
41 0.16
42 0.17
43 0.19
44 0.18
45 0.19
46 0.21
47 0.22
48 0.2
49 0.27
50 0.29
51 0.28
52 0.28
53 0.27
54 0.24
55 0.2
56 0.18
57 0.11
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.1
66 0.1
67 0.1
68 0.12
69 0.16
70 0.24
71 0.28
72 0.35
73 0.38
74 0.45
75 0.53
76 0.62
77 0.67
78 0.69
79 0.71
80 0.7
81 0.69
82 0.67
83 0.62
84 0.51
85 0.44
86 0.34
87 0.28
88 0.22
89 0.2
90 0.15
91 0.16
92 0.14
93 0.12
94 0.13
95 0.12
96 0.12
97 0.12
98 0.13
99 0.1
100 0.12
101 0.12
102 0.11
103 0.11
104 0.1
105 0.09
106 0.08
107 0.08
108 0.11
109 0.13
110 0.14
111 0.16