Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QES4

Protein Details
Accession A0A372QES4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MASIPGSKKRVKRKEISHLKKQCNITHydrophilic
NLS Segment(s)
PositionSequence
8-14KKRVKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MASIPGSKKRVKRKEISHLXKKQCNITQIEEQEEQEPQWISNTXKTSFVXKFFQAKTNGRAYCRYNDNDNGDECRYSCVYKTQTSTMIYHINNIHKEYEKKSEQLKVDKQFKKVTSYKEPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.87
4 0.87
5 0.87
6 0.85
7 0.82
8 0.78
9 0.71
10 0.66
11 0.6
12 0.55
13 0.52
14 0.47
15 0.45
16 0.41
17 0.38
18 0.32
19 0.3
20 0.24
21 0.19
22 0.17
23 0.12
24 0.14
25 0.15
26 0.16
27 0.21
28 0.22
29 0.21
30 0.24
31 0.25
32 0.24
33 0.23
34 0.28
35 0.24
36 0.25
37 0.3
38 0.34
39 0.35
40 0.36
41 0.42
42 0.37
43 0.38
44 0.4
45 0.35
46 0.32
47 0.35
48 0.34
49 0.3
50 0.33
51 0.35
52 0.33
53 0.31
54 0.3
55 0.26
56 0.24
57 0.2
58 0.18
59 0.16
60 0.14
61 0.14
62 0.17
63 0.2
64 0.24
65 0.26
66 0.26
67 0.29
68 0.31
69 0.31
70 0.28
71 0.3
72 0.27
73 0.28
74 0.3
75 0.31
76 0.31
77 0.32
78 0.32
79 0.31
80 0.35
81 0.35
82 0.4
83 0.38
84 0.4
85 0.43
86 0.47
87 0.49
88 0.55
89 0.59
90 0.61
91 0.68
92 0.69
93 0.69
94 0.7
95 0.66
96 0.66
97 0.63
98 0.61