Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RGJ3

Protein Details
Accession A0A372RGJ3   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MWKEKFKRNTFEVIRRRRKNKQNEIISWNNDHydrophilic
35-55LIFGVYKKKSRSKTFKRLGYHHydrophilic
NLS Segment(s)
PositionSequence
42-52KKSRSKTFKRL
58-63NKRGKA
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MWKEKFKRNTFEVIRRRRKNKQNEIISWNNDQGMLIFGVYKKKSRSKTFKRLGYHMFNKRGKAESEKRRNFYNDREFKITDKDRESDVGLGVNSYVSKLIDNFIRNSNRRKLDEDLYLELSFFEKYMGKNKIKFIERKIETDQCIRCKNGVENWEHILICEKNKSSIKEVLERSVADFEERLLIEEKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.87
4 0.87
5 0.88
6 0.89
7 0.9
8 0.89
9 0.88
10 0.86
11 0.85
12 0.82
13 0.77
14 0.69
15 0.59
16 0.49
17 0.38
18 0.31
19 0.23
20 0.16
21 0.12
22 0.08
23 0.08
24 0.09
25 0.16
26 0.18
27 0.22
28 0.26
29 0.34
30 0.42
31 0.51
32 0.61
33 0.65
34 0.75
35 0.8
36 0.82
37 0.8
38 0.78
39 0.75
40 0.73
41 0.72
42 0.69
43 0.7
44 0.65
45 0.62
46 0.58
47 0.54
48 0.47
49 0.47
50 0.48
51 0.49
52 0.57
53 0.62
54 0.61
55 0.63
56 0.66
57 0.61
58 0.6
59 0.6
60 0.57
61 0.54
62 0.56
63 0.52
64 0.48
65 0.52
66 0.47
67 0.41
68 0.36
69 0.33
70 0.29
71 0.3
72 0.29
73 0.22
74 0.17
75 0.13
76 0.1
77 0.09
78 0.08
79 0.06
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.06
87 0.09
88 0.1
89 0.12
90 0.18
91 0.25
92 0.28
93 0.33
94 0.4
95 0.42
96 0.43
97 0.46
98 0.44
99 0.41
100 0.44
101 0.41
102 0.36
103 0.34
104 0.31
105 0.27
106 0.23
107 0.19
108 0.14
109 0.1
110 0.09
111 0.07
112 0.09
113 0.17
114 0.24
115 0.28
116 0.32
117 0.36
118 0.43
119 0.48
120 0.52
121 0.5
122 0.53
123 0.52
124 0.53
125 0.55
126 0.53
127 0.49
128 0.52
129 0.52
130 0.48
131 0.5
132 0.47
133 0.42
134 0.4
135 0.41
136 0.4
137 0.41
138 0.37
139 0.37
140 0.38
141 0.4
142 0.36
143 0.31
144 0.31
145 0.26
146 0.26
147 0.28
148 0.26
149 0.3
150 0.36
151 0.39
152 0.38
153 0.43
154 0.45
155 0.47
156 0.49
157 0.47
158 0.45
159 0.42
160 0.39
161 0.35
162 0.31
163 0.24
164 0.21
165 0.17
166 0.19
167 0.18
168 0.18