Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QAY2

Protein Details
Accession A0A372QAY2   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-122SNDNDNRPGKKRKVRRHQIDQLDDESHydrophilic
NLS Segment(s)
PositionSequence
104-112PGKKRKVRR
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MANAHFLKSPFEHTRTIKPQEFFVELSESLVYRYNNSDYEKHSWLHNEYAHLQGRICEVYRELKEIKVLQAKIKINNLKSQILSQDDANVESSESESNDNDNRPGKKRKVRRHQIDQLDDESETDEENAGIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.6
4 0.59
5 0.53
6 0.53
7 0.51
8 0.5
9 0.4
10 0.34
11 0.29
12 0.23
13 0.23
14 0.2
15 0.15
16 0.13
17 0.17
18 0.15
19 0.12
20 0.15
21 0.16
22 0.19
23 0.23
24 0.25
25 0.25
26 0.31
27 0.32
28 0.3
29 0.29
30 0.29
31 0.28
32 0.3
33 0.27
34 0.24
35 0.23
36 0.28
37 0.29
38 0.26
39 0.23
40 0.2
41 0.2
42 0.18
43 0.16
44 0.11
45 0.1
46 0.15
47 0.16
48 0.18
49 0.17
50 0.17
51 0.19
52 0.19
53 0.21
54 0.22
55 0.22
56 0.21
57 0.28
58 0.3
59 0.3
60 0.36
61 0.37
62 0.33
63 0.38
64 0.39
65 0.34
66 0.32
67 0.3
68 0.26
69 0.25
70 0.24
71 0.19
72 0.18
73 0.17
74 0.17
75 0.17
76 0.14
77 0.11
78 0.1
79 0.11
80 0.09
81 0.09
82 0.1
83 0.09
84 0.12
85 0.15
86 0.16
87 0.19
88 0.24
89 0.28
90 0.34
91 0.44
92 0.51
93 0.58
94 0.68
95 0.75
96 0.8
97 0.86
98 0.9
99 0.91
100 0.91
101 0.91
102 0.88
103 0.82
104 0.73
105 0.64
106 0.54
107 0.43
108 0.35
109 0.25
110 0.17
111 0.14
112 0.11