Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q4C3

Protein Details
Accession A0A372Q4C3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-109DNYKSNKSTSKRKGAVRQLSRNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13, mito 5
Family & Domain DBs
Amino Acid Sequences MGKQPHPFHPYFELVSNPNNKTNKYAVCLCYIEEYTRNIAITKKECHVSNKAKYYHNHLASCENFQKRYDERECAEILSLGNDNYDDNYKSNKSTSKRKGAVRQLSRNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.39
4 0.36
5 0.39
6 0.4
7 0.39
8 0.39
9 0.43
10 0.4
11 0.38
12 0.41
13 0.35
14 0.37
15 0.37
16 0.33
17 0.3
18 0.28
19 0.24
20 0.2
21 0.2
22 0.18
23 0.18
24 0.18
25 0.15
26 0.16
27 0.2
28 0.22
29 0.23
30 0.23
31 0.26
32 0.27
33 0.31
34 0.37
35 0.4
36 0.43
37 0.48
38 0.5
39 0.51
40 0.51
41 0.55
42 0.55
43 0.52
44 0.46
45 0.39
46 0.4
47 0.37
48 0.4
49 0.37
50 0.31
51 0.27
52 0.27
53 0.31
54 0.28
55 0.35
56 0.34
57 0.33
58 0.32
59 0.34
60 0.34
61 0.29
62 0.28
63 0.2
64 0.16
65 0.13
66 0.12
67 0.09
68 0.08
69 0.08
70 0.08
71 0.09
72 0.11
73 0.11
74 0.12
75 0.18
76 0.19
77 0.21
78 0.25
79 0.31
80 0.35
81 0.45
82 0.53
83 0.59
84 0.64
85 0.72
86 0.77
87 0.81
88 0.85
89 0.84