Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372Q381

Protein Details
Accession A0A372Q381    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-53ISPGIWTKRAKCKKKRVKRLERDVRFLKBasic
NLS Segment(s)
PositionSequence
33-45KRAKCKKKRVKRL
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVTDQNNLSDSTPTEQEVIRYIYKDISPGIWTKRAKCKKKRVKRLERDVRFLKVELEDLDECVDRKTVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.18
5 0.19
6 0.17
7 0.17
8 0.17
9 0.17
10 0.17
11 0.17
12 0.15
13 0.12
14 0.12
15 0.15
16 0.17
17 0.22
18 0.24
19 0.27
20 0.37
21 0.46
22 0.54
23 0.61
24 0.7
25 0.74
26 0.83
27 0.9
28 0.91
29 0.92
30 0.93
31 0.95
32 0.94
33 0.89
34 0.87
35 0.8
36 0.73
37 0.63
38 0.53
39 0.44
40 0.34
41 0.3
42 0.22
43 0.23
44 0.19
45 0.17
46 0.19
47 0.17
48 0.17
49 0.16
50 0.17