Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RE84

Protein Details
Accession A0A372RE84    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
189-213SGKVTFKKRKLASQSNTRNIRKKKCHydrophilic
NLS Segment(s)
PositionSequence
14-35KFLRNIRRKDHENRKEEEKTRR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040023  WBP4  
Gene Ontology GO:0000398  P:mRNA splicing, via spliceosome  
Amino Acid Sequences MHEQGKKHKENVEKFLRNIRRKDHENRKEEEKTRRELERIERAAMKQYKKDIILEVPGASIASLKSTSNTNAPPVISSFSEHDVIYADSTTNYTELAELSKSSKSADGTEAVIGEWRPVTPPPAPPAAPSVNNALETDQGNNTSTSQEAILQDDEEDEDPDDLRNFKVVEKTFPLDDQIPEDILKDNNSGKVTFKKRKLASQSNTRNIRKKKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.75
4 0.73
5 0.72
6 0.71
7 0.69
8 0.71
9 0.79
10 0.79
11 0.79
12 0.78
13 0.77
14 0.77
15 0.77
16 0.76
17 0.76
18 0.71
19 0.68
20 0.67
21 0.66
22 0.6
23 0.57
24 0.58
25 0.58
26 0.55
27 0.51
28 0.48
29 0.45
30 0.51
31 0.52
32 0.47
33 0.41
34 0.44
35 0.45
36 0.43
37 0.43
38 0.36
39 0.32
40 0.31
41 0.28
42 0.23
43 0.18
44 0.16
45 0.14
46 0.11
47 0.09
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.09
54 0.11
55 0.14
56 0.15
57 0.16
58 0.17
59 0.17
60 0.17
61 0.16
62 0.17
63 0.13
64 0.14
65 0.13
66 0.14
67 0.15
68 0.14
69 0.13
70 0.12
71 0.12
72 0.11
73 0.09
74 0.07
75 0.06
76 0.06
77 0.07
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.05
85 0.06
86 0.07
87 0.08
88 0.08
89 0.08
90 0.1
91 0.1
92 0.11
93 0.11
94 0.11
95 0.11
96 0.11
97 0.11
98 0.09
99 0.09
100 0.08
101 0.07
102 0.06
103 0.05
104 0.06
105 0.06
106 0.09
107 0.1
108 0.13
109 0.15
110 0.18
111 0.18
112 0.18
113 0.23
114 0.23
115 0.22
116 0.21
117 0.22
118 0.2
119 0.21
120 0.2
121 0.16
122 0.14
123 0.14
124 0.14
125 0.11
126 0.11
127 0.11
128 0.11
129 0.12
130 0.1
131 0.1
132 0.09
133 0.09
134 0.1
135 0.1
136 0.12
137 0.11
138 0.11
139 0.11
140 0.1
141 0.11
142 0.09
143 0.1
144 0.08
145 0.08
146 0.08
147 0.09
148 0.1
149 0.1
150 0.09
151 0.11
152 0.11
153 0.13
154 0.2
155 0.21
156 0.24
157 0.29
158 0.31
159 0.3
160 0.3
161 0.32
162 0.27
163 0.26
164 0.24
165 0.21
166 0.19
167 0.18
168 0.18
169 0.17
170 0.16
171 0.17
172 0.16
173 0.17
174 0.21
175 0.22
176 0.22
177 0.25
178 0.33
179 0.42
180 0.49
181 0.54
182 0.6
183 0.63
184 0.71
185 0.78
186 0.78
187 0.77
188 0.79
189 0.82
190 0.82
191 0.87
192 0.86
193 0.85