Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RLZ4

Protein Details
Accession A0A372RLZ4    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-34TIIESKYKRSKCPECNKRRKPLDESHQIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences LIQPTQTIIESKYKRSKCPECNKRRKPLDESHQICHVCYKIKMVYKYGSSGNKIIDDFIRYTQINLVNVNGKMEYVPYEQFINIEFIAEGGFSEIYKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.67
4 0.68
5 0.77
6 0.79
7 0.81
8 0.89
9 0.91
10 0.92
11 0.91
12 0.87
13 0.84
14 0.82
15 0.81
16 0.8
17 0.74
18 0.67
19 0.64
20 0.57
21 0.5
22 0.42
23 0.34
24 0.26
25 0.22
26 0.23
27 0.21
28 0.26
29 0.27
30 0.28
31 0.29
32 0.27
33 0.29
34 0.3
35 0.27
36 0.24
37 0.24
38 0.22
39 0.2
40 0.19
41 0.18
42 0.14
43 0.13
44 0.13
45 0.12
46 0.15
47 0.13
48 0.14
49 0.17
50 0.19
51 0.18
52 0.17
53 0.18
54 0.18
55 0.18
56 0.19
57 0.15
58 0.12
59 0.11
60 0.11
61 0.13
62 0.11
63 0.12
64 0.13
65 0.14
66 0.14
67 0.14
68 0.15
69 0.15
70 0.12
71 0.12
72 0.1
73 0.09
74 0.09
75 0.09
76 0.07
77 0.06
78 0.06
79 0.05