Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RDV7

Protein Details
Accession A0A372RDV7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-62CQMRECYRKLEKKKLKNRSNENKSENHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MKLWDANAEHRPTAKELYKILKELHEEDKKFNNEIRCQMRECYRKLEKKKLKNRSNENKSENIKLILKQSIQSNLYGYFNNRSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.33
4 0.4
5 0.4
6 0.4
7 0.39
8 0.36
9 0.35
10 0.35
11 0.4
12 0.4
13 0.38
14 0.39
15 0.45
16 0.44
17 0.42
18 0.42
19 0.38
20 0.34
21 0.41
22 0.43
23 0.38
24 0.38
25 0.39
26 0.44
27 0.43
28 0.42
29 0.42
30 0.45
31 0.5
32 0.56
33 0.64
34 0.65
35 0.7
36 0.79
37 0.81
38 0.81
39 0.82
40 0.86
41 0.86
42 0.86
43 0.85
44 0.79
45 0.77
46 0.72
47 0.67
48 0.58
49 0.51
50 0.44
51 0.37
52 0.36
53 0.32
54 0.3
55 0.28
56 0.3
57 0.33
58 0.31
59 0.3
60 0.28
61 0.26
62 0.27
63 0.26
64 0.25