Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R8L7

Protein Details
Accession A0A372R8L7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45FLSTNKTKKQKKKLLFLFLCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, E.R. 6, plas 5, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTLFFSTFFFFFFSLIISKIFNSLNFLSTNKTKKQKKKLLFLFLCKYMLTFLICNNFFTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.09
6 0.11
7 0.12
8 0.11
9 0.14
10 0.14
11 0.15
12 0.15
13 0.16
14 0.17
15 0.21
16 0.25
17 0.27
18 0.36
19 0.43
20 0.51
21 0.62
22 0.68
23 0.71
24 0.77
25 0.8
26 0.82
27 0.78
28 0.76
29 0.71
30 0.63
31 0.57
32 0.46
33 0.37
34 0.27
35 0.24
36 0.18
37 0.14
38 0.14
39 0.22
40 0.23
41 0.23