Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RAV3

Protein Details
Accession A0A372RAV3    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-29GENKREGSKRVKRMGKGKMKGBasic
97-121EKGKQVNICTRKPKKNDNNNKTAEPHydrophilic
NLS Segment(s)
PositionSequence
4-77EKRREGENKREGSKRVKRMGKGKMKGKGKTKGKERENERKGEGKTEGKGKNERERENEREGEGKTKGKGETKGR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MEREKRREGENKREGSKRVKRMGKGKMKGKGKTKGKERENERKGEGKTEGKGKNERERENEREGEGKTKGKGETKGRSSFHINKDVHFWPRQTREIEKGKQVNICTRKPKKNDNNNKTAEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.72
4 0.71
5 0.71
6 0.71
7 0.72
8 0.75
9 0.8
10 0.8
11 0.79
12 0.77
13 0.77
14 0.77
15 0.77
16 0.77
17 0.76
18 0.75
19 0.75
20 0.76
21 0.77
22 0.77
23 0.78
24 0.78
25 0.79
26 0.75
27 0.71
28 0.65
29 0.62
30 0.55
31 0.51
32 0.47
33 0.39
34 0.37
35 0.4
36 0.4
37 0.37
38 0.43
39 0.43
40 0.48
41 0.51
42 0.52
43 0.5
44 0.53
45 0.54
46 0.53
47 0.5
48 0.42
49 0.38
50 0.35
51 0.32
52 0.27
53 0.24
54 0.2
55 0.21
56 0.23
57 0.24
58 0.3
59 0.33
60 0.39
61 0.43
62 0.49
63 0.47
64 0.48
65 0.52
66 0.54
67 0.52
68 0.53
69 0.47
70 0.4
71 0.45
72 0.45
73 0.43
74 0.38
75 0.35
76 0.34
77 0.4
78 0.44
79 0.43
80 0.44
81 0.48
82 0.54
83 0.56
84 0.57
85 0.56
86 0.55
87 0.55
88 0.54
89 0.55
90 0.53
91 0.56
92 0.58
93 0.63
94 0.68
95 0.71
96 0.79
97 0.81
98 0.85
99 0.89
100 0.88
101 0.88