Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q957

Protein Details
Accession A0A372Q957   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-79HYKATCYHCKKKWSRRRPVALKAHLAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MTETARTDLQKHSNNTLTETPLSQKKANKGDPKFDEIWQYFQYFTQGEELNPGHYKATCYHCKKKWSRRRPVALKAHLANECLACAEDISKYWRDKLAENTVNYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.48
4 0.42
5 0.36
6 0.33
7 0.31
8 0.31
9 0.34
10 0.34
11 0.36
12 0.4
13 0.48
14 0.55
15 0.6
16 0.58
17 0.63
18 0.63
19 0.65
20 0.59
21 0.51
22 0.5
23 0.41
24 0.41
25 0.33
26 0.3
27 0.24
28 0.22
29 0.23
30 0.15
31 0.14
32 0.13
33 0.12
34 0.11
35 0.14
36 0.14
37 0.14
38 0.14
39 0.14
40 0.11
41 0.11
42 0.13
43 0.13
44 0.2
45 0.27
46 0.34
47 0.43
48 0.48
49 0.58
50 0.66
51 0.73
52 0.78
53 0.8
54 0.83
55 0.85
56 0.9
57 0.89
58 0.9
59 0.89
60 0.84
61 0.8
62 0.71
63 0.66
64 0.56
65 0.48
66 0.39
67 0.29
68 0.23
69 0.17
70 0.15
71 0.09
72 0.08
73 0.08
74 0.07
75 0.09
76 0.13
77 0.18
78 0.19
79 0.22
80 0.27
81 0.28
82 0.32
83 0.39
84 0.46
85 0.47