Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RNR4

Protein Details
Accession A0A372RNR4   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKPTRPKRVRSKTRTVRARTPNGYHydrophilic
NLS Segment(s)
PositionSequence
3-17KKPTRPKRVRSKTRT
Subcellular Location(s) mito 14, mito_nucl 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKKPTRPKRVRSKTRTVRARTPNGYIVFYKKYYKFLKLDNPRLPSQEIGRLMGKIWRDHLPYYLKNEFLKYAEVESQIKNFNTMVVPASSTSVLSFDRSYEELFEKYIQYPPYPPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.87
5 0.86
6 0.84
7 0.85
8 0.77
9 0.72
10 0.68
11 0.6
12 0.55
13 0.47
14 0.42
15 0.36
16 0.35
17 0.36
18 0.31
19 0.36
20 0.37
21 0.42
22 0.4
23 0.42
24 0.5
25 0.54
26 0.62
27 0.6
28 0.61
29 0.57
30 0.56
31 0.52
32 0.43
33 0.35
34 0.31
35 0.25
36 0.23
37 0.22
38 0.2
39 0.18
40 0.19
41 0.19
42 0.13
43 0.15
44 0.16
45 0.17
46 0.17
47 0.21
48 0.24
49 0.24
50 0.31
51 0.3
52 0.29
53 0.28
54 0.28
55 0.25
56 0.21
57 0.21
58 0.15
59 0.15
60 0.14
61 0.16
62 0.17
63 0.16
64 0.18
65 0.2
66 0.19
67 0.19
68 0.17
69 0.16
70 0.14
71 0.14
72 0.13
73 0.1
74 0.11
75 0.1
76 0.12
77 0.1
78 0.1
79 0.1
80 0.1
81 0.1
82 0.11
83 0.11
84 0.1
85 0.14
86 0.15
87 0.15
88 0.17
89 0.19
90 0.17
91 0.19
92 0.2
93 0.19
94 0.2
95 0.24
96 0.23
97 0.23