Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QGA7

Protein Details
Accession A0A372QGA7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSETTDQRKKRLCKKRIEKVNLPPLLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSETTDQRKKRLCKKRIEKVNLPPLLEPPPYLLNLYTSSRSDANTFCKNIRGYNSLLACTSFGAKINEEFQRKGDLDENILQNLQNMLDEYNPYVQNFRQIRDVIQANEATEISMLIHSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.89
4 0.89
5 0.88
6 0.87
7 0.89
8 0.81
9 0.72
10 0.62
11 0.54
12 0.49
13 0.4
14 0.3
15 0.23
16 0.21
17 0.2
18 0.2
19 0.17
20 0.14
21 0.17
22 0.19
23 0.18
24 0.17
25 0.18
26 0.18
27 0.19
28 0.19
29 0.18
30 0.22
31 0.24
32 0.26
33 0.24
34 0.28
35 0.28
36 0.29
37 0.3
38 0.26
39 0.23
40 0.27
41 0.27
42 0.22
43 0.22
44 0.19
45 0.16
46 0.13
47 0.12
48 0.07
49 0.08
50 0.09
51 0.09
52 0.1
53 0.13
54 0.18
55 0.2
56 0.2
57 0.19
58 0.23
59 0.23
60 0.24
61 0.24
62 0.19
63 0.21
64 0.24
65 0.25
66 0.2
67 0.2
68 0.18
69 0.15
70 0.15
71 0.11
72 0.07
73 0.07
74 0.06
75 0.07
76 0.08
77 0.09
78 0.13
79 0.14
80 0.14
81 0.16
82 0.16
83 0.25
84 0.26
85 0.27
86 0.28
87 0.28
88 0.3
89 0.35
90 0.39
91 0.31
92 0.33
93 0.32
94 0.26
95 0.27
96 0.25
97 0.18
98 0.14
99 0.12
100 0.09