Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A2RAE9

Protein Details
Accession A2RAE9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-31RLVTDRRSKRFLPKKRLRKLLRNNIDGIHydrophilic
NLS Segment(s)
PositionSequence
9-26RRSKRFLPKKRLRKLLRN
37-38RR
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPRLVTDRRSKRFLPKKRLRKLLRNNIDGITRPSIRRLARRGGVIRISADVYPEVRKTVKNRLTEIIRQIILVMESSTTPGHERKLVRTQDIRVLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.76
4 0.81
5 0.85
6 0.91
7 0.89
8 0.89
9 0.9
10 0.9
11 0.88
12 0.81
13 0.74
14 0.65
15 0.58
16 0.49
17 0.42
18 0.35
19 0.28
20 0.25
21 0.25
22 0.29
23 0.3
24 0.35
25 0.36
26 0.38
27 0.38
28 0.43
29 0.43
30 0.4
31 0.39
32 0.33
33 0.29
34 0.23
35 0.21
36 0.15
37 0.13
38 0.1
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.14
45 0.17
46 0.27
47 0.33
48 0.35
49 0.38
50 0.42
51 0.46
52 0.47
53 0.48
54 0.42
55 0.36
56 0.32
57 0.29
58 0.24
59 0.19
60 0.15
61 0.1
62 0.06
63 0.06
64 0.08
65 0.08
66 0.08
67 0.11
68 0.12
69 0.15
70 0.21
71 0.23
72 0.29
73 0.39
74 0.43
75 0.48
76 0.52
77 0.53