Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RQW1

Protein Details
Accession A0A372RQW1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
85-113MPTLPKGVNKPKNKKSKLSVNPNNKMKDIHydrophilic
NLS Segment(s)
PositionSequence
94-99KPKNKK
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
Amino Acid Sequences MVVRIRLARHGIKIRNRPFYNIVVANAKTPRDGKHIEKVGLYDPIPNELGIKNVELNTDRIKYWLSVGAWPSDTVARLLSKAGIMPTLPKGVNKPKNKKSKLSVNPNNKMKDISSEQNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.71
4 0.68
5 0.64
6 0.59
7 0.57
8 0.48
9 0.43
10 0.37
11 0.36
12 0.35
13 0.33
14 0.29
15 0.25
16 0.25
17 0.25
18 0.25
19 0.3
20 0.3
21 0.37
22 0.42
23 0.41
24 0.4
25 0.38
26 0.34
27 0.32
28 0.28
29 0.21
30 0.16
31 0.17
32 0.16
33 0.15
34 0.14
35 0.11
36 0.12
37 0.1
38 0.1
39 0.09
40 0.09
41 0.1
42 0.1
43 0.12
44 0.13
45 0.14
46 0.13
47 0.13
48 0.13
49 0.12
50 0.12
51 0.14
52 0.12
53 0.13
54 0.14
55 0.15
56 0.15
57 0.15
58 0.14
59 0.11
60 0.11
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.07
71 0.07
72 0.09
73 0.11
74 0.14
75 0.14
76 0.15
77 0.21
78 0.31
79 0.4
80 0.49
81 0.57
82 0.63
83 0.74
84 0.79
85 0.81
86 0.79
87 0.81
88 0.81
89 0.82
90 0.83
91 0.83
92 0.87
93 0.86
94 0.82
95 0.72
96 0.64
97 0.54
98 0.51
99 0.47