Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RM55

Protein Details
Accession A0A372RM55    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-38IQKINLDNNKRIRRKPQRLCYNCKETIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MSHKQSRTHPYIQKINLDNNKRIRRKPQRLCYNCKETIDYVKLVSNKVNKIEEIVNNFKNLQKKPDKLSKFNAKFTLNNVPCELEYDLSSFTLENLQKLVTITTQFYNPNSSSSDNSSESSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.66
4 0.65
5 0.64
6 0.65
7 0.71
8 0.7
9 0.72
10 0.73
11 0.76
12 0.81
13 0.84
14 0.85
15 0.86
16 0.87
17 0.9
18 0.87
19 0.84
20 0.77
21 0.68
22 0.6
23 0.51
24 0.5
25 0.43
26 0.35
27 0.28
28 0.27
29 0.26
30 0.24
31 0.26
32 0.24
33 0.24
34 0.27
35 0.27
36 0.23
37 0.24
38 0.26
39 0.25
40 0.26
41 0.28
42 0.26
43 0.25
44 0.26
45 0.26
46 0.29
47 0.27
48 0.29
49 0.31
50 0.34
51 0.39
52 0.48
53 0.51
54 0.49
55 0.57
56 0.6
57 0.58
58 0.59
59 0.59
60 0.52
61 0.48
62 0.47
63 0.49
64 0.4
65 0.37
66 0.33
67 0.29
68 0.26
69 0.28
70 0.25
71 0.15
72 0.14
73 0.13
74 0.13
75 0.11
76 0.12
77 0.09
78 0.08
79 0.14
80 0.14
81 0.13
82 0.13
83 0.13
84 0.13
85 0.14
86 0.15
87 0.1
88 0.12
89 0.14
90 0.14
91 0.17
92 0.19
93 0.19
94 0.24
95 0.23
96 0.23
97 0.24
98 0.26
99 0.26
100 0.29
101 0.33
102 0.3