Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QK45

Protein Details
Accession A0A372QK45   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-34VNGLWCMFRRRNKECKCKKNCDWKCKDLLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MILNVNGLWCMFRRRNKECKCKKNCDWKCKDLLTNKNKWQCEDRLCRCQQQHNMKWLNKNKWSCQHDQKCETERKYQRDWLFLNEWKSEEYTQELLNEYLKKKSQSEQNQFFKRVWIEIIAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.6
3 0.69
4 0.79
5 0.82
6 0.85
7 0.87
8 0.89
9 0.9
10 0.91
11 0.9
12 0.9
13 0.88
14 0.84
15 0.82
16 0.77
17 0.74
18 0.72
19 0.72
20 0.69
21 0.7
22 0.71
23 0.71
24 0.67
25 0.62
26 0.59
27 0.55
28 0.56
29 0.57
30 0.56
31 0.57
32 0.59
33 0.63
34 0.6
35 0.62
36 0.62
37 0.62
38 0.61
39 0.61
40 0.66
41 0.62
42 0.68
43 0.68
44 0.66
45 0.63
46 0.61
47 0.57
48 0.58
49 0.6
50 0.58
51 0.6
52 0.62
53 0.61
54 0.62
55 0.62
56 0.59
57 0.62
58 0.59
59 0.58
60 0.57
61 0.56
62 0.56
63 0.58
64 0.54
65 0.53
66 0.51
67 0.47
68 0.45
69 0.43
70 0.42
71 0.35
72 0.33
73 0.28
74 0.29
75 0.24
76 0.19
77 0.19
78 0.17
79 0.16
80 0.17
81 0.17
82 0.16
83 0.19
84 0.22
85 0.2
86 0.23
87 0.27
88 0.29
89 0.3
90 0.36
91 0.43
92 0.49
93 0.59
94 0.64
95 0.7
96 0.75
97 0.74
98 0.68
99 0.64
100 0.55
101 0.46
102 0.38
103 0.3