Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QH77

Protein Details
Accession A0A372QH77    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
115-149QHVIPRNHKNNDPKEKRKRPKRRVPHTTQENVRTVBasic
NLS Segment(s)
PositionSequence
27-35GRRGRKIKP
123-137KNNDPKEKRKRPKRR
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR004088  KH_dom_type_1  
IPR036612  KH_dom_type_1_sf  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00013  KH_1  
PROSITE View protein in PROSITE  
PS50084  KH_TYPE_1  
Amino Acid Sequences MQNSIKSLTISTTMEIPKHVEIGKLIGRRGRKIKPIEKGTGTHILITTEENLRQIEFSINKDDKDKDENISPEERINEAICQIDKLIEDIEIRNRRKDIEKEGGNGRILDNRNQQHVIPRNHKNNDPKEKRKRPKRRVPHTTQENVRTVNHTNYNQSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.2
5 0.23
6 0.23
7 0.18
8 0.17
9 0.21
10 0.26
11 0.26
12 0.27
13 0.28
14 0.32
15 0.38
16 0.45
17 0.46
18 0.49
19 0.56
20 0.61
21 0.67
22 0.7
23 0.7
24 0.65
25 0.6
26 0.57
27 0.55
28 0.47
29 0.38
30 0.31
31 0.25
32 0.22
33 0.21
34 0.18
35 0.12
36 0.12
37 0.12
38 0.12
39 0.11
40 0.11
41 0.11
42 0.13
43 0.13
44 0.14
45 0.21
46 0.22
47 0.23
48 0.25
49 0.26
50 0.24
51 0.27
52 0.27
53 0.21
54 0.24
55 0.25
56 0.25
57 0.26
58 0.24
59 0.2
60 0.19
61 0.18
62 0.14
63 0.13
64 0.11
65 0.09
66 0.1
67 0.08
68 0.08
69 0.07
70 0.07
71 0.06
72 0.07
73 0.06
74 0.06
75 0.07
76 0.08
77 0.16
78 0.23
79 0.25
80 0.27
81 0.27
82 0.29
83 0.34
84 0.38
85 0.37
86 0.39
87 0.4
88 0.42
89 0.45
90 0.46
91 0.4
92 0.36
93 0.29
94 0.26
95 0.25
96 0.27
97 0.32
98 0.31
99 0.34
100 0.35
101 0.35
102 0.37
103 0.45
104 0.48
105 0.48
106 0.55
107 0.61
108 0.64
109 0.71
110 0.71
111 0.73
112 0.76
113 0.77
114 0.79
115 0.81
116 0.88
117 0.92
118 0.94
119 0.95
120 0.94
121 0.95
122 0.96
123 0.95
124 0.95
125 0.93
126 0.93
127 0.92
128 0.9
129 0.87
130 0.83
131 0.76
132 0.68
133 0.61
134 0.54
135 0.49
136 0.47
137 0.46
138 0.42