Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R3T7

Protein Details
Accession A0A372R3T7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MCYKNKERKRKDETTKNRKKSISKVBasic
NLS Segment(s)
PositionSequence
6-20KERKRKDETTKNRKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MCYKNKERKRKDETTKNRKKSISKVITTITTEASTTTSQIDVPQMPFSIETINEIYNEQIKKVDNLVLKSKETIETRNQEIRDLYEQISHRRSELIDLIEMANNKLNDLKEFSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.9
4 0.89
5 0.85
6 0.81
7 0.79
8 0.79
9 0.77
10 0.69
11 0.64
12 0.59
13 0.56
14 0.51
15 0.42
16 0.33
17 0.23
18 0.2
19 0.16
20 0.16
21 0.12
22 0.11
23 0.11
24 0.09
25 0.09
26 0.1
27 0.11
28 0.11
29 0.12
30 0.12
31 0.11
32 0.11
33 0.11
34 0.11
35 0.09
36 0.08
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.12
44 0.12
45 0.11
46 0.11
47 0.11
48 0.12
49 0.13
50 0.17
51 0.15
52 0.18
53 0.24
54 0.25
55 0.25
56 0.25
57 0.25
58 0.25
59 0.25
60 0.26
61 0.26
62 0.28
63 0.33
64 0.37
65 0.37
66 0.34
67 0.33
68 0.33
69 0.3
70 0.28
71 0.24
72 0.24
73 0.26
74 0.3
75 0.33
76 0.3
77 0.26
78 0.26
79 0.25
80 0.24
81 0.26
82 0.22
83 0.19
84 0.2
85 0.2
86 0.21
87 0.21
88 0.19
89 0.19
90 0.17
91 0.17
92 0.19
93 0.19
94 0.2