Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2QHL4

Protein Details
Accession A2QHL4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-80YKQGRLKVWPKPRLRRKIGRAGECHBasic
NLS Segment(s)
PositionSequence
62-74KVWPKPRLRRKIG
Subcellular Location(s) nucl 9, mito 6, cyto 4, cysk 4, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MLLLEGTSIYSANDPAGHMNLSRKYLSICIGLKGILSSYICHEERAIWTPQFHGIYKQGRLKVWPKPRLRRKIGRAGECHSFQRLPHALSHCRQTVADCCIVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.12
4 0.12
5 0.12
6 0.18
7 0.2
8 0.23
9 0.22
10 0.21
11 0.21
12 0.22
13 0.23
14 0.23
15 0.2
16 0.18
17 0.18
18 0.18
19 0.16
20 0.15
21 0.13
22 0.09
23 0.08
24 0.08
25 0.09
26 0.15
27 0.15
28 0.15
29 0.15
30 0.14
31 0.16
32 0.19
33 0.2
34 0.15
35 0.15
36 0.16
37 0.19
38 0.19
39 0.17
40 0.16
41 0.19
42 0.21
43 0.26
44 0.3
45 0.29
46 0.28
47 0.33
48 0.35
49 0.39
50 0.46
51 0.5
52 0.55
53 0.63
54 0.73
55 0.79
56 0.83
57 0.84
58 0.82
59 0.84
60 0.83
61 0.8
62 0.75
63 0.69
64 0.66
65 0.59
66 0.53
67 0.46
68 0.38
69 0.3
70 0.34
71 0.34
72 0.3
73 0.33
74 0.37
75 0.39
76 0.41
77 0.48
78 0.41
79 0.39
80 0.38
81 0.36
82 0.36
83 0.35