Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B947

Protein Details
Accession A0A376B947   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
111-142EYNKLRKRGKIINSSNKKRRRKLGVTSTNSNNHydrophilic
NLS Segment(s)
PositionSequence
115-132LRKRGKIINSSNKKRRRK
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0120114  C:Sm-like protein family complex  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MKLVKFLTNLKNEQVSVELKNGTTVWGTVQNVSPSMNLILTEVTLSLPVSNKNQNHNYSAISSVYMNGELDAQNKSSSKLQYINIRGNTIRQIILPDSLNLDNLLIEDQNEYNKLRKRGKIINSSNKKRRRKLGVTSTNSNNDSSSTDGNSNKRIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.25
4 0.26
5 0.23
6 0.19
7 0.21
8 0.2
9 0.17
10 0.14
11 0.13
12 0.12
13 0.16
14 0.17
15 0.17
16 0.2
17 0.2
18 0.2
19 0.2
20 0.18
21 0.14
22 0.14
23 0.12
24 0.09
25 0.09
26 0.08
27 0.07
28 0.07
29 0.06
30 0.05
31 0.05
32 0.05
33 0.06
34 0.07
35 0.09
36 0.12
37 0.19
38 0.22
39 0.29
40 0.35
41 0.37
42 0.38
43 0.38
44 0.35
45 0.3
46 0.29
47 0.22
48 0.16
49 0.13
50 0.11
51 0.1
52 0.09
53 0.08
54 0.06
55 0.07
56 0.06
57 0.08
58 0.07
59 0.08
60 0.08
61 0.09
62 0.1
63 0.13
64 0.13
65 0.14
66 0.17
67 0.19
68 0.25
69 0.29
70 0.34
71 0.32
72 0.33
73 0.31
74 0.29
75 0.28
76 0.23
77 0.19
78 0.13
79 0.14
80 0.12
81 0.14
82 0.14
83 0.11
84 0.13
85 0.13
86 0.13
87 0.11
88 0.1
89 0.08
90 0.08
91 0.08
92 0.05
93 0.05
94 0.06
95 0.07
96 0.08
97 0.1
98 0.11
99 0.17
100 0.23
101 0.31
102 0.37
103 0.41
104 0.48
105 0.55
106 0.62
107 0.67
108 0.71
109 0.74
110 0.78
111 0.84
112 0.86
113 0.87
114 0.88
115 0.86
116 0.85
117 0.85
118 0.83
119 0.83
120 0.84
121 0.85
122 0.83
123 0.82
124 0.78
125 0.75
126 0.67
127 0.57
128 0.46
129 0.37
130 0.32
131 0.28
132 0.24
133 0.2
134 0.24
135 0.29
136 0.33
137 0.4