Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B726

Protein Details
Accession A0A376B726   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-28PSPWIVKYSKTKKREYYFNPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
IPR001202  WW_dom  
IPR036020  WW_dom_sf  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0060255  P:regulation of macromolecule metabolic process  
GO:0051171  P:regulation of nitrogen compound metabolic process  
GO:0080090  P:regulation of primary metabolic process  
Pfam View protein in Pfam  
PF00639  Rotamase  
PF00397  WW  
PROSITE View protein in PROSITE  
PS50198  PPIC_PPIASE_2  
PS50020  WW_DOMAIN_2  
CDD cd00201  WW  
Amino Acid Sequences MSDIASGLPSPWIVKYSKTKKREYYFNPETKESHWEPPSGTDYVRLKDYLREHPVRIRCLHILIKHRDSRRPSSHHNPHITITKAEAAKELERYRDAIFNKGASFEEIARERSDCNSYKRGGDLGFFGRGEMQPDFEKAAFALKVGEISGIVDTESGLHLIKRIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.29
3 0.39
4 0.48
5 0.55
6 0.63
7 0.7
8 0.76
9 0.8
10 0.78
11 0.78
12 0.78
13 0.78
14 0.74
15 0.68
16 0.62
17 0.54
18 0.53
19 0.46
20 0.44
21 0.39
22 0.35
23 0.33
24 0.35
25 0.37
26 0.3
27 0.26
28 0.25
29 0.26
30 0.26
31 0.27
32 0.24
33 0.21
34 0.26
35 0.3
36 0.32
37 0.37
38 0.38
39 0.38
40 0.45
41 0.49
42 0.48
43 0.45
44 0.4
45 0.33
46 0.34
47 0.37
48 0.34
49 0.37
50 0.4
51 0.45
52 0.47
53 0.49
54 0.52
55 0.53
56 0.57
57 0.56
58 0.55
59 0.56
60 0.6
61 0.67
62 0.68
63 0.67
64 0.6
65 0.55
66 0.54
67 0.47
68 0.36
69 0.28
70 0.24
71 0.2
72 0.18
73 0.18
74 0.15
75 0.15
76 0.19
77 0.19
78 0.17
79 0.17
80 0.19
81 0.18
82 0.22
83 0.21
84 0.2
85 0.2
86 0.2
87 0.19
88 0.19
89 0.18
90 0.14
91 0.14
92 0.11
93 0.14
94 0.14
95 0.16
96 0.15
97 0.16
98 0.15
99 0.17
100 0.22
101 0.21
102 0.25
103 0.28
104 0.29
105 0.3
106 0.31
107 0.3
108 0.26
109 0.23
110 0.21
111 0.19
112 0.2
113 0.18
114 0.17
115 0.17
116 0.16
117 0.19
118 0.16
119 0.16
120 0.14
121 0.16
122 0.19
123 0.16
124 0.16
125 0.13
126 0.17
127 0.14
128 0.13
129 0.13
130 0.1
131 0.11
132 0.11
133 0.11
134 0.07
135 0.08
136 0.08
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.07
143 0.07
144 0.07
145 0.07