Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B6L9

Protein Details
Accession A0A376B6L9   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSLEAKPYYKHFPKKHNDKRSAGIITHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20, cyto_nucl 13.5, nucl 3, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014033  Arginase  
IPR006035  Ureohydrolase  
IPR023696  Ureohydrolase_dom_sf  
IPR020855  Ureohydrolase_Mn_BS  
Gene Ontology GO:0004053  F:arginase activity  
GO:0046872  F:metal ion binding  
GO:0006525  P:arginine metabolic process  
GO:0051171  P:regulation of nitrogen compound metabolic process  
GO:0080090  P:regulation of primary metabolic process  
GO:0000050  P:urea cycle  
Pfam View protein in Pfam  
PF00491  Arginase  
PROSITE View protein in PROSITE  
PS01053  ARGINASE_1  
PS51409  ARGINASE_2  
CDD cd09989  Arginase  
Amino Acid Sequences MSLEAKPYYKHFPKKHNDKRSAGIITAPFSGGQAKSGVENGPKYLLKHGLQQQLDDLGWETSIEEPLKNTDFEERKLASTKASSNGKVKRADLVGEATKLVYESCKKVSNDENKFQITLGGDHSIAIGSIHAVLEKYPDAGILWIDAHADINTPSTTDSGNLHGCPVSFLLGLDRENCPEELKWVKPGILKPNKIAYIGLRDVDDGERKILRDLNISCFSMHHVDRFGINKVVEMALDKVTGGEKDCPVMVSYDVDGIDPLFVPATGTPVRGGLTLREGLFICERVAESGNLVALDVVECNPELASHDLHVVDTISAGCAIVRCTLGETLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.89
4 0.89
5 0.84
6 0.82
7 0.8
8 0.73
9 0.62
10 0.57
11 0.48
12 0.41
13 0.36
14 0.3
15 0.21
16 0.18
17 0.21
18 0.15
19 0.14
20 0.13
21 0.13
22 0.13
23 0.15
24 0.18
25 0.18
26 0.2
27 0.2
28 0.24
29 0.26
30 0.26
31 0.29
32 0.33
33 0.3
34 0.37
35 0.43
36 0.46
37 0.45
38 0.44
39 0.41
40 0.37
41 0.35
42 0.27
43 0.2
44 0.12
45 0.11
46 0.1
47 0.09
48 0.08
49 0.11
50 0.11
51 0.1
52 0.11
53 0.15
54 0.17
55 0.17
56 0.17
57 0.22
58 0.25
59 0.26
60 0.32
61 0.29
62 0.3
63 0.33
64 0.33
65 0.27
66 0.27
67 0.28
68 0.29
69 0.33
70 0.34
71 0.39
72 0.45
73 0.48
74 0.48
75 0.46
76 0.43
77 0.39
78 0.37
79 0.3
80 0.29
81 0.25
82 0.22
83 0.21
84 0.16
85 0.15
86 0.14
87 0.12
88 0.11
89 0.12
90 0.14
91 0.17
92 0.24
93 0.25
94 0.29
95 0.37
96 0.44
97 0.48
98 0.51
99 0.52
100 0.46
101 0.46
102 0.42
103 0.35
104 0.26
105 0.2
106 0.16
107 0.13
108 0.12
109 0.11
110 0.11
111 0.09
112 0.08
113 0.07
114 0.05
115 0.03
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.06
123 0.06
124 0.05
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.05
131 0.04
132 0.05
133 0.05
134 0.05
135 0.04
136 0.05
137 0.05
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.08
146 0.1
147 0.11
148 0.11
149 0.11
150 0.11
151 0.1
152 0.1
153 0.09
154 0.07
155 0.06
156 0.06
157 0.06
158 0.07
159 0.08
160 0.09
161 0.09
162 0.09
163 0.1
164 0.11
165 0.11
166 0.1
167 0.13
168 0.15
169 0.16
170 0.19
171 0.18
172 0.2
173 0.22
174 0.26
175 0.33
176 0.38
177 0.39
178 0.38
179 0.43
180 0.42
181 0.39
182 0.36
183 0.27
184 0.25
185 0.24
186 0.22
187 0.16
188 0.15
189 0.16
190 0.17
191 0.18
192 0.12
193 0.13
194 0.13
195 0.13
196 0.15
197 0.17
198 0.16
199 0.2
200 0.21
201 0.26
202 0.28
203 0.29
204 0.27
205 0.24
206 0.26
207 0.24
208 0.23
209 0.17
210 0.16
211 0.16
212 0.18
213 0.2
214 0.2
215 0.19
216 0.18
217 0.17
218 0.17
219 0.17
220 0.14
221 0.13
222 0.12
223 0.09
224 0.09
225 0.09
226 0.08
227 0.09
228 0.1
229 0.1
230 0.12
231 0.12
232 0.13
233 0.13
234 0.13
235 0.13
236 0.13
237 0.12
238 0.1
239 0.1
240 0.11
241 0.11
242 0.11
243 0.1
244 0.09
245 0.09
246 0.07
247 0.07
248 0.05
249 0.05
250 0.06
251 0.05
252 0.1
253 0.1
254 0.11
255 0.11
256 0.12
257 0.13
258 0.13
259 0.14
260 0.11
261 0.14
262 0.17
263 0.17
264 0.18
265 0.18
266 0.19
267 0.21
268 0.2
269 0.16
270 0.14
271 0.14
272 0.14
273 0.16
274 0.13
275 0.12
276 0.12
277 0.13
278 0.11
279 0.11
280 0.09
281 0.07
282 0.07
283 0.07
284 0.06
285 0.06
286 0.06
287 0.07
288 0.07
289 0.07
290 0.1
291 0.11
292 0.13
293 0.13
294 0.15
295 0.15
296 0.15
297 0.16
298 0.14
299 0.11
300 0.1
301 0.09
302 0.08
303 0.07
304 0.07
305 0.07
306 0.07
307 0.09
308 0.1
309 0.11
310 0.1
311 0.13