Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B5S8

Protein Details
Accession A0A376B5S8    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSYKSNNKKKLKNVPDGYDKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001748  BUD31  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01125  G10  
Amino Acid Sequences MSYKSNNKKKLKNVPDGYDKIKQVLDDYDHQLRLITINNKKDTGTNNSNLMSNDEDLWEIYKINHLKSKYIYDLYYKRKIINAKLYHWLLNNNIVDRHLIAKWKKRGYEKLCCIRCIEQSNGSSVTSKDGIKGKVCICRVPKSVLLSKEKERQKNNNEEEGKNTPDDDDLFKVVIKPCGRCGCNGCASTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.78
4 0.74
5 0.7
6 0.61
7 0.53
8 0.46
9 0.38
10 0.31
11 0.3
12 0.28
13 0.26
14 0.31
15 0.33
16 0.32
17 0.32
18 0.3
19 0.26
20 0.23
21 0.24
22 0.27
23 0.29
24 0.36
25 0.39
26 0.39
27 0.4
28 0.42
29 0.4
30 0.41
31 0.4
32 0.36
33 0.37
34 0.36
35 0.38
36 0.35
37 0.32
38 0.25
39 0.19
40 0.17
41 0.14
42 0.13
43 0.11
44 0.12
45 0.1
46 0.08
47 0.08
48 0.13
49 0.15
50 0.17
51 0.21
52 0.2
53 0.23
54 0.25
55 0.3
56 0.27
57 0.28
58 0.26
59 0.28
60 0.35
61 0.39
62 0.44
63 0.41
64 0.38
65 0.4
66 0.43
67 0.42
68 0.44
69 0.42
70 0.37
71 0.42
72 0.43
73 0.4
74 0.37
75 0.33
76 0.24
77 0.26
78 0.23
79 0.18
80 0.17
81 0.16
82 0.15
83 0.14
84 0.15
85 0.09
86 0.14
87 0.18
88 0.26
89 0.33
90 0.37
91 0.41
92 0.45
93 0.54
94 0.56
95 0.62
96 0.63
97 0.66
98 0.64
99 0.61
100 0.58
101 0.51
102 0.48
103 0.42
104 0.36
105 0.32
106 0.3
107 0.32
108 0.3
109 0.28
110 0.24
111 0.19
112 0.19
113 0.15
114 0.15
115 0.16
116 0.19
117 0.21
118 0.22
119 0.27
120 0.27
121 0.32
122 0.33
123 0.36
124 0.35
125 0.4
126 0.42
127 0.41
128 0.42
129 0.41
130 0.46
131 0.47
132 0.49
133 0.47
134 0.5
135 0.55
136 0.59
137 0.61
138 0.64
139 0.67
140 0.69
141 0.75
142 0.75
143 0.76
144 0.73
145 0.66
146 0.65
147 0.59
148 0.53
149 0.43
150 0.37
151 0.28
152 0.24
153 0.25
154 0.22
155 0.2
156 0.18
157 0.18
158 0.18
159 0.22
160 0.23
161 0.28
162 0.28
163 0.28
164 0.35
165 0.44
166 0.44
167 0.46
168 0.48
169 0.48
170 0.52