Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B110

Protein Details
Accession A0A376B110   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-108MNQAKRRRGKGAPPKKKEVNGGKNKTKKRKBasic
NLS Segment(s)
PositionSequence
82-108AKRRRGKGAPPKKKEVNGGKNKTKKRK
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSIPKNRLLKLAETSARIFDQNFNQTNVRTGAKILSKRLKGPSIAEYYGNPDFIKFKHLKILYPDFNFVDKNEEYRLSMNQAKRRRGKGAPPKKKEVNGGKNKTKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.35
4 0.31
5 0.27
6 0.23
7 0.26
8 0.31
9 0.32
10 0.32
11 0.33
12 0.32
13 0.34
14 0.33
15 0.27
16 0.2
17 0.18
18 0.19
19 0.24
20 0.27
21 0.31
22 0.36
23 0.37
24 0.4
25 0.44
26 0.43
27 0.38
28 0.38
29 0.36
30 0.33
31 0.32
32 0.28
33 0.24
34 0.26
35 0.25
36 0.23
37 0.17
38 0.12
39 0.12
40 0.12
41 0.18
42 0.14
43 0.14
44 0.21
45 0.22
46 0.24
47 0.28
48 0.36
49 0.35
50 0.35
51 0.37
52 0.31
53 0.31
54 0.3
55 0.24
56 0.22
57 0.17
58 0.17
59 0.17
60 0.17
61 0.17
62 0.18
63 0.19
64 0.19
65 0.25
66 0.29
67 0.36
68 0.43
69 0.51
70 0.57
71 0.62
72 0.63
73 0.64
74 0.68
75 0.71
76 0.75
77 0.77
78 0.76
79 0.8
80 0.81
81 0.8
82 0.79
83 0.79
84 0.78
85 0.78
86 0.8
87 0.82
88 0.84