Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B5V4

Protein Details
Accession A0A376B5V4   
Localization Confidence High
Confidence Score 22.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-49LPGFNANKINKQKKVHKKNSVQLISEHydrophilic
58-93NEFDSQKLKKQRKLKEKKEIKKRKNDEKWLEKQAKSBasic
147-173ATDIKLVESRKRKQNKKKTQFTTSTDGHydrophilic
NLS Segment(s)
PositionSequence
64-111KLKKQRKLKEKKEIKKRKNDEKWLEKQAKSEILKQHKEKGTLTPKEQK
115-116KK
156-163RKRKQNKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MTTLSKSAKAQAKIAVSNVLDSFLPGFNANKINKQKKVHKKNSVQLISENLKKRVELNEFDSQKLKKQRKLKEKKEIKKRKNDEKWLEKQAKSEILKQHKEKGTLTPKEQKVLNKKIIANRKRLEEWDLDEDIQEELNDVQQEILQATDIKLVESRKRKQNKKKTQFTTSTDGTQNTGTHGKRYTGLTPGLAPVGLSDDESSDNGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.31
4 0.3
5 0.27
6 0.23
7 0.17
8 0.16
9 0.16
10 0.11
11 0.12
12 0.11
13 0.12
14 0.14
15 0.21
16 0.22
17 0.29
18 0.39
19 0.47
20 0.54
21 0.62
22 0.69
23 0.73
24 0.83
25 0.85
26 0.85
27 0.86
28 0.86
29 0.88
30 0.83
31 0.74
32 0.65
33 0.61
34 0.55
35 0.53
36 0.49
37 0.42
38 0.37
39 0.35
40 0.36
41 0.36
42 0.36
43 0.33
44 0.34
45 0.4
46 0.41
47 0.42
48 0.44
49 0.37
50 0.39
51 0.46
52 0.47
53 0.45
54 0.52
55 0.61
56 0.68
57 0.78
58 0.81
59 0.83
60 0.86
61 0.88
62 0.91
63 0.92
64 0.9
65 0.9
66 0.89
67 0.89
68 0.88
69 0.89
70 0.87
71 0.85
72 0.83
73 0.82
74 0.8
75 0.7
76 0.62
77 0.55
78 0.52
79 0.44
80 0.43
81 0.41
82 0.42
83 0.48
84 0.47
85 0.53
86 0.48
87 0.49
88 0.44
89 0.45
90 0.46
91 0.44
92 0.46
93 0.47
94 0.45
95 0.45
96 0.47
97 0.44
98 0.44
99 0.48
100 0.49
101 0.45
102 0.47
103 0.52
104 0.59
105 0.58
106 0.57
107 0.53
108 0.51
109 0.49
110 0.47
111 0.44
112 0.36
113 0.35
114 0.31
115 0.29
116 0.24
117 0.22
118 0.21
119 0.18
120 0.15
121 0.11
122 0.07
123 0.05
124 0.07
125 0.07
126 0.06
127 0.06
128 0.06
129 0.07
130 0.06
131 0.06
132 0.05
133 0.06
134 0.06
135 0.09
136 0.09
137 0.09
138 0.12
139 0.15
140 0.22
141 0.31
142 0.38
143 0.44
144 0.55
145 0.65
146 0.74
147 0.82
148 0.86
149 0.88
150 0.92
151 0.9
152 0.89
153 0.87
154 0.82
155 0.78
156 0.69
157 0.63
158 0.55
159 0.48
160 0.4
161 0.34
162 0.28
163 0.25
164 0.29
165 0.25
166 0.26
167 0.28
168 0.28
169 0.28
170 0.32
171 0.31
172 0.29
173 0.31
174 0.28
175 0.27
176 0.26
177 0.24
178 0.19
179 0.16
180 0.11
181 0.13
182 0.11
183 0.11
184 0.1
185 0.11
186 0.12