Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B9B3

Protein Details
Accession A0A376B9B3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
131-155IVESKSVRYRKKLEQKSKEKRVSWFHydrophilic
NLS Segment(s)
PositionSequence
103-108KPKGHK
140-149RKKLEQKSKE
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSNKEYFELLPAVLKNFFKKYPPTIQYSVKPTSTNSITANPFLFNRHPVTNKAHDPKYSLRRMSVLYKLAKLYGVESFLPPITNKKFFEEKYEAKKFMRGVIKPKGHKHELSAESRMKKMQDAIKNADKFIVESKSVRYRKKLEQKSKEKRVSWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.27
4 0.28
5 0.29
6 0.34
7 0.39
8 0.46
9 0.48
10 0.51
11 0.52
12 0.57
13 0.58
14 0.59
15 0.56
16 0.48
17 0.44
18 0.38
19 0.39
20 0.35
21 0.32
22 0.28
23 0.29
24 0.29
25 0.29
26 0.29
27 0.24
28 0.22
29 0.22
30 0.22
31 0.2
32 0.22
33 0.24
34 0.26
35 0.28
36 0.34
37 0.37
38 0.43
39 0.47
40 0.46
41 0.43
42 0.45
43 0.49
44 0.51
45 0.52
46 0.45
47 0.39
48 0.38
49 0.4
50 0.4
51 0.36
52 0.33
53 0.28
54 0.28
55 0.27
56 0.25
57 0.23
58 0.19
59 0.16
60 0.11
61 0.11
62 0.09
63 0.09
64 0.1
65 0.09
66 0.09
67 0.08
68 0.13
69 0.15
70 0.19
71 0.2
72 0.23
73 0.29
74 0.28
75 0.36
76 0.38
77 0.4
78 0.45
79 0.5
80 0.48
81 0.43
82 0.46
83 0.39
84 0.39
85 0.41
86 0.34
87 0.36
88 0.43
89 0.51
90 0.53
91 0.6
92 0.6
93 0.58
94 0.56
95 0.53
96 0.53
97 0.51
98 0.5
99 0.49
100 0.48
101 0.45
102 0.46
103 0.45
104 0.36
105 0.31
106 0.33
107 0.34
108 0.36
109 0.39
110 0.45
111 0.52
112 0.52
113 0.51
114 0.47
115 0.39
116 0.32
117 0.31
118 0.27
119 0.21
120 0.21
121 0.27
122 0.35
123 0.42
124 0.46
125 0.5
126 0.53
127 0.61
128 0.71
129 0.76
130 0.77
131 0.81
132 0.87
133 0.9
134 0.94
135 0.93