Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B531

Protein Details
Accession A0A376B531    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68FKEAKKRKVAERKPLVWSRIHydrophilic
NLS Segment(s)
PositionSequence
44-63KRHVLFKEAKKRKVAERKPL
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR038584  L33_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MAKVKSKTTVIKLISTALTGFSRQLAIKRGAPLVKQIRYDPIAKRHVLFKEAKKRKVAERKPLVWSRIQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.23
4 0.17
5 0.15
6 0.13
7 0.12
8 0.1
9 0.11
10 0.11
11 0.13
12 0.15
13 0.18
14 0.2
15 0.21
16 0.24
17 0.24
18 0.23
19 0.29
20 0.32
21 0.32
22 0.3
23 0.29
24 0.3
25 0.31
26 0.34
27 0.31
28 0.32
29 0.34
30 0.33
31 0.34
32 0.36
33 0.35
34 0.37
35 0.39
36 0.41
37 0.47
38 0.55
39 0.6
40 0.6
41 0.63
42 0.68
43 0.73
44 0.73
45 0.73
46 0.74
47 0.74
48 0.77
49 0.8
50 0.73