Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B1Z8

Protein Details
Accession A0A376B1Z8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-113TQVYRKQNSKNGFHKRRRRFMDRFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008402  APC_su15/mnd2  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
Pfam View protein in Pfam  
PF05841  Apc15p  
Amino Acid Sequences MFSSSILENISDSNLADINYNDNQNNEKNNNNNNIECLTYTKKTLFDTTFFRHIQEELNGNGNNNATYNARGAANLNRISGNNSNIEERTQVYRKQNSKNGFHKRRRRFMDRFIPLNAYTPSTDIPFFTFNENDVACNMMFEENYRYMNSLRKDIKYLGWNTFVPIGCDKTMAELEHYLKEEERNTLQIKELDYSNRVLRRSLYENNNNTNNNHDTSVHSVNMDINLDGDITDSYDMGQDYAMVEEDEYEYEEHGQYEHNSYLYNEELGEQGHNEGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.11
5 0.15
6 0.18
7 0.21
8 0.21
9 0.21
10 0.25
11 0.29
12 0.36
13 0.35
14 0.38
15 0.43
16 0.5
17 0.57
18 0.57
19 0.53
20 0.49
21 0.46
22 0.41
23 0.33
24 0.31
25 0.28
26 0.25
27 0.27
28 0.26
29 0.28
30 0.29
31 0.34
32 0.32
33 0.3
34 0.35
35 0.38
36 0.42
37 0.4
38 0.39
39 0.34
40 0.32
41 0.31
42 0.28
43 0.25
44 0.2
45 0.25
46 0.24
47 0.23
48 0.24
49 0.21
50 0.18
51 0.15
52 0.15
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.14
60 0.17
61 0.22
62 0.22
63 0.22
64 0.22
65 0.22
66 0.26
67 0.27
68 0.24
69 0.21
70 0.21
71 0.22
72 0.21
73 0.22
74 0.18
75 0.17
76 0.21
77 0.22
78 0.27
79 0.32
80 0.4
81 0.47
82 0.54
83 0.59
84 0.6
85 0.65
86 0.69
87 0.73
88 0.75
89 0.78
90 0.8
91 0.83
92 0.86
93 0.85
94 0.84
95 0.79
96 0.78
97 0.79
98 0.75
99 0.68
100 0.6
101 0.56
102 0.46
103 0.43
104 0.34
105 0.24
106 0.18
107 0.16
108 0.15
109 0.13
110 0.12
111 0.1
112 0.11
113 0.11
114 0.11
115 0.12
116 0.12
117 0.11
118 0.13
119 0.13
120 0.11
121 0.1
122 0.11
123 0.08
124 0.08
125 0.07
126 0.05
127 0.05
128 0.06
129 0.09
130 0.09
131 0.1
132 0.1
133 0.11
134 0.12
135 0.18
136 0.18
137 0.23
138 0.25
139 0.25
140 0.28
141 0.28
142 0.3
143 0.31
144 0.33
145 0.28
146 0.28
147 0.27
148 0.26
149 0.28
150 0.25
151 0.2
152 0.19
153 0.18
154 0.15
155 0.15
156 0.14
157 0.12
158 0.14
159 0.12
160 0.12
161 0.13
162 0.15
163 0.16
164 0.17
165 0.16
166 0.15
167 0.17
168 0.17
169 0.17
170 0.17
171 0.19
172 0.2
173 0.2
174 0.22
175 0.22
176 0.22
177 0.2
178 0.21
179 0.19
180 0.19
181 0.21
182 0.24
183 0.25
184 0.25
185 0.24
186 0.24
187 0.27
188 0.32
189 0.37
190 0.41
191 0.46
192 0.51
193 0.57
194 0.61
195 0.57
196 0.52
197 0.49
198 0.43
199 0.36
200 0.32
201 0.27
202 0.24
203 0.28
204 0.3
205 0.25
206 0.22
207 0.21
208 0.2
209 0.21
210 0.19
211 0.12
212 0.09
213 0.09
214 0.09
215 0.08
216 0.07
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.07
223 0.08
224 0.07
225 0.07
226 0.06
227 0.07
228 0.07
229 0.08
230 0.06
231 0.06
232 0.07
233 0.08
234 0.08
235 0.09
236 0.08
237 0.09
238 0.1
239 0.11
240 0.11
241 0.1
242 0.12
243 0.13
244 0.17
245 0.18
246 0.16
247 0.17
248 0.17
249 0.2
250 0.19
251 0.18
252 0.14
253 0.13
254 0.14
255 0.14
256 0.14
257 0.12