Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A376B6Y5

Protein Details
Accession A0A376B6Y5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-27DYPFEKRKEESERIRRNFKNBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004241  Atg8-like  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0000421  C:autophagosome membrane  
GO:0031410  C:cytoplasmic vesicle  
GO:0006914  P:autophagy  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF02991  ATG8  
CDD cd16128  Ubl_ATG8  
Amino Acid Sequences MKSAFKSDYPFEKRKEESERIRRNFKNRIAVICEKADKSDIPDIDKRKYLVPNDLTVGQFVYVIRKRIRLPPEKAIFIFVNDTLPPTAALMHAIYEEHKDKDGFLYVQYSGENTFGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.61
4 0.63
5 0.68
6 0.74
7 0.73
8 0.8
9 0.79
10 0.78
11 0.79
12 0.75
13 0.74
14 0.67
15 0.65
16 0.62
17 0.61
18 0.56
19 0.5
20 0.46
21 0.36
22 0.34
23 0.3
24 0.23
25 0.22
26 0.24
27 0.21
28 0.23
29 0.28
30 0.31
31 0.32
32 0.34
33 0.31
34 0.29
35 0.33
36 0.3
37 0.33
38 0.31
39 0.3
40 0.29
41 0.3
42 0.26
43 0.21
44 0.19
45 0.11
46 0.1
47 0.08
48 0.12
49 0.12
50 0.16
51 0.17
52 0.2
53 0.22
54 0.29
55 0.38
56 0.41
57 0.44
58 0.5
59 0.54
60 0.53
61 0.51
62 0.48
63 0.4
64 0.32
65 0.28
66 0.19
67 0.16
68 0.13
69 0.14
70 0.1
71 0.11
72 0.09
73 0.08
74 0.08
75 0.07
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.12
83 0.15
84 0.15
85 0.17
86 0.17
87 0.17
88 0.2
89 0.23
90 0.19
91 0.18
92 0.2
93 0.18
94 0.19
95 0.19
96 0.17
97 0.14