Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B284

Protein Details
Accession A0A376B284    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYDRVSENBasic
NLS Segment(s)
PositionSequence
9-21KIVKKHTKKFKRH
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYDRVSENWRKQKGIDSVVRRRFRGNISEPTIGYGSNKKTKYLSPSGHKVVSVSNIKDLELLTMHTRTFAAEIAHNVSSKNRVVILAKAKALGVKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.92
11 0.9
12 0.88
13 0.83
14 0.72
15 0.66
16 0.66
17 0.64
18 0.64
19 0.64
20 0.59
21 0.54
22 0.54
23 0.58
24 0.54
25 0.52
26 0.5
27 0.49
28 0.56
29 0.64
30 0.67
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.42
37 0.41
38 0.42
39 0.43
40 0.41
41 0.39
42 0.36
43 0.28
44 0.23
45 0.19
46 0.18
47 0.23
48 0.24
49 0.23
50 0.24
51 0.27
52 0.32
53 0.35
54 0.37
55 0.35
56 0.41
57 0.43
58 0.42
59 0.4
60 0.34
61 0.27
62 0.27
63 0.25
64 0.2
65 0.2
66 0.2
67 0.2
68 0.2
69 0.19
70 0.14
71 0.1
72 0.11
73 0.1
74 0.11
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.09
82 0.1
83 0.11
84 0.15
85 0.16
86 0.16
87 0.16
88 0.16
89 0.18
90 0.18
91 0.18
92 0.15
93 0.16
94 0.17
95 0.23
96 0.3
97 0.3
98 0.3
99 0.29
100 0.29
101 0.28
102 0.27
103 0.24
104 0.19
105 0.22
106 0.3
107 0.37
108 0.43
109 0.43
110 0.44
111 0.45