Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376BCA9

Protein Details
Accession A0A376BCA9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-43LKATFLYLKKWKRKYSNEDTRPVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 9, cyto_nucl 6.5, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001662  EF1B_G_C  
IPR036433  EF1B_G_C_sf  
Gene Ontology GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF00647  EF1G  
PROSITE View protein in PROSITE  
PS50040  EF1G_C  
Amino Acid Sequences MLPMLLWIPKPLGRSLSLLLKATFLYLKKWKRKYSNEDTRPVALPWFWEHYNPEEYSIWKVAYKYNDELTMTFMSNNLVGGFFNRLSGSVKYMFGCLVVYGENNNNGIIGAILIKGQNFKPAFDVAPDWESYSYEKLDPVNKPEDKEFVNDMWAWDKPVVINGETREIADGKVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.32
4 0.32
5 0.32
6 0.3
7 0.28
8 0.26
9 0.24
10 0.24
11 0.17
12 0.2
13 0.28
14 0.37
15 0.46
16 0.55
17 0.63
18 0.69
19 0.79
20 0.82
21 0.84
22 0.86
23 0.84
24 0.82
25 0.76
26 0.69
27 0.61
28 0.51
29 0.41
30 0.3
31 0.24
32 0.21
33 0.22
34 0.19
35 0.19
36 0.2
37 0.23
38 0.27
39 0.25
40 0.25
41 0.21
42 0.22
43 0.23
44 0.23
45 0.2
46 0.17
47 0.17
48 0.18
49 0.2
50 0.23
51 0.22
52 0.22
53 0.23
54 0.23
55 0.22
56 0.22
57 0.19
58 0.16
59 0.13
60 0.12
61 0.1
62 0.1
63 0.09
64 0.06
65 0.05
66 0.04
67 0.05
68 0.07
69 0.06
70 0.07
71 0.07
72 0.07
73 0.1
74 0.1
75 0.12
76 0.11
77 0.12
78 0.12
79 0.12
80 0.12
81 0.09
82 0.09
83 0.07
84 0.06
85 0.05
86 0.05
87 0.06
88 0.07
89 0.08
90 0.08
91 0.08
92 0.07
93 0.07
94 0.07
95 0.05
96 0.04
97 0.04
98 0.03
99 0.04
100 0.04
101 0.05
102 0.07
103 0.07
104 0.15
105 0.15
106 0.15
107 0.17
108 0.18
109 0.19
110 0.18
111 0.2
112 0.15
113 0.16
114 0.16
115 0.15
116 0.14
117 0.15
118 0.15
119 0.15
120 0.15
121 0.13
122 0.14
123 0.16
124 0.22
125 0.24
126 0.27
127 0.34
128 0.35
129 0.37
130 0.38
131 0.39
132 0.35
133 0.36
134 0.34
135 0.26
136 0.27
137 0.24
138 0.24
139 0.23
140 0.22
141 0.2
142 0.17
143 0.17
144 0.14
145 0.18
146 0.2
147 0.17
148 0.21
149 0.2
150 0.26
151 0.25
152 0.25
153 0.23
154 0.21
155 0.2