Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376BDM4

Protein Details
Accession A0A376BDM4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
161-186EDMMKAMAKKKHKNKKQPHHSSSATSHydrophilic
NLS Segment(s)
PositionSequence
168-177AKKKHKNKKQ
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 10.666, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005522  IPK  
Gene Ontology GO:0016301  F:kinase activity  
GO:0032958  P:inositol phosphate biosynthetic process  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MLFDSSPELLNIDENAIVDEEEEKEEDEKQENITEDINNSNIGSATAPHTLETIQQSSSSTLIKTVSKGNQNQEKGRKKENPEEEDQDQEYPLAVELEPFNNKVGGHTAIFRFSKMAVCKALVNRENRWYENIELNHEDLLQFMPKYIGVLNVRQHYNSHEDMMKAMAKKKHKNKKQPHHSSSATSSEKNMTSVVIPVSRVVQILFQPLPTVHQTLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.08
6 0.09
7 0.09
8 0.1
9 0.1
10 0.1
11 0.11
12 0.13
13 0.15
14 0.17
15 0.16
16 0.17
17 0.2
18 0.2
19 0.2
20 0.2
21 0.19
22 0.18
23 0.18
24 0.17
25 0.14
26 0.13
27 0.12
28 0.1
29 0.1
30 0.09
31 0.08
32 0.1
33 0.12
34 0.12
35 0.12
36 0.12
37 0.12
38 0.15
39 0.17
40 0.16
41 0.14
42 0.14
43 0.15
44 0.15
45 0.17
46 0.15
47 0.11
48 0.11
49 0.12
50 0.13
51 0.13
52 0.18
53 0.22
54 0.28
55 0.33
56 0.4
57 0.46
58 0.49
59 0.55
60 0.6
61 0.64
62 0.62
63 0.66
64 0.65
65 0.63
66 0.68
67 0.7
68 0.66
69 0.62
70 0.63
71 0.56
72 0.52
73 0.47
74 0.38
75 0.28
76 0.22
77 0.16
78 0.11
79 0.09
80 0.06
81 0.05
82 0.05
83 0.06
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.09
90 0.09
91 0.11
92 0.1
93 0.1
94 0.11
95 0.12
96 0.14
97 0.15
98 0.14
99 0.12
100 0.11
101 0.15
102 0.14
103 0.16
104 0.14
105 0.14
106 0.17
107 0.18
108 0.25
109 0.26
110 0.28
111 0.28
112 0.34
113 0.36
114 0.35
115 0.35
116 0.31
117 0.28
118 0.31
119 0.29
120 0.26
121 0.25
122 0.24
123 0.22
124 0.19
125 0.17
126 0.11
127 0.11
128 0.09
129 0.07
130 0.07
131 0.07
132 0.07
133 0.08
134 0.08
135 0.12
136 0.12
137 0.17
138 0.22
139 0.26
140 0.27
141 0.27
142 0.28
143 0.25
144 0.29
145 0.26
146 0.24
147 0.21
148 0.2
149 0.2
150 0.22
151 0.23
152 0.2
153 0.24
154 0.28
155 0.35
156 0.45
157 0.55
158 0.63
159 0.7
160 0.79
161 0.84
162 0.89
163 0.92
164 0.93
165 0.9
166 0.87
167 0.8
168 0.75
169 0.68
170 0.66
171 0.58
172 0.48
173 0.43
174 0.39
175 0.37
176 0.32
177 0.27
178 0.19
179 0.16
180 0.17
181 0.18
182 0.15
183 0.15
184 0.15
185 0.16
186 0.16
187 0.16
188 0.14
189 0.14
190 0.14
191 0.19
192 0.19
193 0.17
194 0.18
195 0.18
196 0.22
197 0.22
198 0.23