Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A376B1E3

Protein Details
Accession A0A376B1E3   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
205-231NNNNNSNNINRNKNRSRNKTSSRYIPYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF10197  Cir_N  
Amino Acid Sequences MGVGDLNLLKSWNPHLVKNQKKVWEVEQNLLNEEKKIRERQLEIKKEKELQELTSLDRNPNSLDTHDDRNTKRKNNGLEWMYNDPTVNKTENNKNNKQETEDDDMLLGKKNISLKTSSNLKKKKKFTGDINSVVGTTTPSNHTSNNSKTLSDDPMKNIVNKAKFQNLDPLNMIKSNTGNGNNKYNQDDPMSSFLKPNNRSRSSNNNNNNSNNINRNKNRSRNKTSSRYIPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.38
3 0.48
4 0.57
5 0.64
6 0.68
7 0.66
8 0.68
9 0.68
10 0.66
11 0.65
12 0.59
13 0.56
14 0.54
15 0.48
16 0.46
17 0.45
18 0.38
19 0.29
20 0.28
21 0.28
22 0.29
23 0.35
24 0.38
25 0.41
26 0.46
27 0.54
28 0.62
29 0.67
30 0.67
31 0.66
32 0.66
33 0.65
34 0.63
35 0.6
36 0.51
37 0.42
38 0.42
39 0.38
40 0.36
41 0.36
42 0.34
43 0.29
44 0.27
45 0.26
46 0.21
47 0.22
48 0.21
49 0.16
50 0.21
51 0.22
52 0.28
53 0.32
54 0.37
55 0.37
56 0.45
57 0.52
58 0.52
59 0.54
60 0.54
61 0.55
62 0.54
63 0.6
64 0.54
65 0.5
66 0.47
67 0.47
68 0.42
69 0.36
70 0.31
71 0.23
72 0.21
73 0.2
74 0.17
75 0.15
76 0.19
77 0.28
78 0.36
79 0.44
80 0.49
81 0.53
82 0.57
83 0.56
84 0.54
85 0.48
86 0.45
87 0.45
88 0.38
89 0.32
90 0.26
91 0.26
92 0.22
93 0.2
94 0.14
95 0.06
96 0.08
97 0.11
98 0.12
99 0.13
100 0.15
101 0.15
102 0.2
103 0.29
104 0.34
105 0.39
106 0.47
107 0.55
108 0.61
109 0.66
110 0.71
111 0.7
112 0.7
113 0.7
114 0.71
115 0.69
116 0.65
117 0.6
118 0.51
119 0.42
120 0.36
121 0.26
122 0.17
123 0.11
124 0.08
125 0.09
126 0.12
127 0.13
128 0.14
129 0.18
130 0.23
131 0.26
132 0.31
133 0.3
134 0.27
135 0.28
136 0.3
137 0.32
138 0.3
139 0.29
140 0.25
141 0.3
142 0.31
143 0.3
144 0.32
145 0.32
146 0.32
147 0.33
148 0.34
149 0.35
150 0.35
151 0.35
152 0.41
153 0.36
154 0.35
155 0.33
156 0.32
157 0.26
158 0.27
159 0.26
160 0.18
161 0.17
162 0.16
163 0.18
164 0.23
165 0.28
166 0.3
167 0.37
168 0.39
169 0.41
170 0.44
171 0.41
172 0.38
173 0.35
174 0.33
175 0.29
176 0.31
177 0.3
178 0.26
179 0.27
180 0.29
181 0.35
182 0.39
183 0.45
184 0.5
185 0.54
186 0.58
187 0.62
188 0.69
189 0.69
190 0.74
191 0.74
192 0.73
193 0.74
194 0.72
195 0.7
196 0.64
197 0.61
198 0.59
199 0.57
200 0.58
201 0.58
202 0.65
203 0.71
204 0.76
205 0.81
206 0.82
207 0.85
208 0.85
209 0.88
210 0.88
211 0.86